Recombinant Human DLK1 protein, His-tagged

Cat.No. : DLK1-188H
Product Overview : Recombinant Human DLK1(Ala24-Pro297) fused with His tag at C-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : Ala24-Pro297
Form : Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
AA Sequence : AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRD VRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASH ASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQ NGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPNGYGLAYRLTPGVHELPVQQPEHR ILKVSMKELNKKTPVDHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name DLK1 delta-like 1 homolog (Drosophila) [ Homo sapiens ]
Official Symbol DLK1
Synonyms DLK1; delta-like 1 homolog (Drosophila); delta like homolog (Drosophila); protein delta homolog 1; Delta1; FA1; pG2; Pref 1; ZOG; DLK-1; secredeltin; fetal antigen 1; preadipocyte factor 1; DLK; PREF1; Pref-1;
Gene ID 8788
mRNA Refseq NM_003836
Protein Refseq NP_003827
MIM 176290
UniProt ID P80370
Chromosome Location 14q32
Pathway Activated NOTCH1 Transmits Signal to the Nucleus, organism-specific biosystem; Adipogenesis, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by NOTCH, organism-specific biosystem; Signaling by NOTCH1, organism-specific biosystem;
Function molecular_function;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DLK1 Products

Required fields are marked with *

My Review for All DLK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon