Recombinant Human DLK1 protein, His-tagged
| Cat.No. : | DLK1-188H |
| Product Overview : | Recombinant Human DLK1(Ala24-Pro297) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | Ala24-Pro297 |
| Form : | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| AA Sequence : | AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRD VRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASH ASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQ NGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPNGYGLAYRLTPGVHELPVQQPEHR ILKVSMKELNKKTPVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Shipping : | The product is shipped at ambient temperature. |
| Gene Name | DLK1 delta-like 1 homolog (Drosophila) [ Homo sapiens ] |
| Official Symbol | DLK1 |
| Synonyms | DLK1; delta-like 1 homolog (Drosophila); delta like homolog (Drosophila); protein delta homolog 1; Delta1; FA1; pG2; Pref 1; ZOG; DLK-1; secredeltin; fetal antigen 1; preadipocyte factor 1; DLK; PREF1; Pref-1; |
| Gene ID | 8788 |
| mRNA Refseq | NM_003836 |
| Protein Refseq | NP_003827 |
| MIM | 176290 |
| UniProt ID | P80370 |
| Chromosome Location | 14q32 |
| Pathway | Activated NOTCH1 Transmits Signal to the Nucleus, organism-specific biosystem; Adipogenesis, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by NOTCH, organism-specific biosystem; Signaling by NOTCH1, organism-specific biosystem; |
| Function | molecular_function; |
| ◆ Recombinant Proteins | ||
| DLK1-5007H | Recombinant Human DLK1 protein, Flag-Myc-tagged | +Inquiry |
| DLK1-187H | Recombinant Human DLK1 protein, His-tagged | +Inquiry |
| DLK1-1347H | Recombinant Human DLK1 Protein, His&GST-tagged | +Inquiry |
| DLK1-5391H | Recombinant Human DLK1 protein, His-tagged | +Inquiry |
| Dlk1-1841R | Recombinant Rat Dlk1 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DLK1-6909HCL | Recombinant Human DLK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLK1 Products
Required fields are marked with *
My Review for All DLK1 Products
Required fields are marked with *
