Recombinant Human DLL1 protein, His-tagged
| Cat.No. : | DLL1-4344H |
| Product Overview : | Recombinant Human DLL1 protein(18-178 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Tag : | His |
| Protein Length : | 18-178 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | QVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFV |
| Gene Name | DLL1 delta-like 1 (Drosophila) [ Homo sapiens ] |
| Official Symbol | DLL1 |
| Synonyms | DLL1; delta-like 1 (Drosophila); delta (Drosophila) like 1; delta-like protein 1; H-Delta-1; drosophila Delta homolog 1; DL1; Delta; DELTA1; |
| Gene ID | 28514 |
| mRNA Refseq | NM_005618 |
| Protein Refseq | NP_005609 |
| MIM | 606582 |
| UniProt ID | O00548 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLL1 Products
Required fields are marked with *
My Review for All DLL1 Products
Required fields are marked with *
