Recombinant Human DLL1 protein, His-tagged
Cat.No. : | DLL1-4345H |
Product Overview : | Recombinant Human DLL1 protein(569-708 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | His |
Protein Length : | 569-708 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | VRLRLQKHRPPADPCRGETETMNNLANCQREKDISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSKRDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSKDTKYQSVY |
Gene Name | DLL1 delta-like 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | DLL1 |
Synonyms | DLL1; delta-like 1 (Drosophila); delta (Drosophila) like 1; delta-like protein 1; H-Delta-1; drosophila Delta homolog 1; DL1; Delta; DELTA1; |
Gene ID | 28514 |
mRNA Refseq | NM_005618 |
Protein Refseq | NP_005609 |
MIM | 606582 |
UniProt ID | O00548 |
◆ Recombinant Proteins | ||
DLL1-13C | Recombinant Chicken DLL1 Protein, His-tagged | +Inquiry |
DLL1-2802H | Recombinant Human DLL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DLL1-200H | Recombinant Human DLL1 Protein, His-tagged | +Inquiry |
RFL704RF | Recombinant Full Length Rat Delta-Like Protein 1(Dll1) Protein, His-Tagged | +Inquiry |
DLL1-802H | Recombinant Human DLL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLL1-2461HCL | Recombinant Human DLL1 cell lysate | +Inquiry |
DLL1-2029MCL | Recombinant Mouse DLL1 cell lysate | +Inquiry |
DLL1-001RCL | Recombinant Rat DLL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLL1 Products
Required fields are marked with *
My Review for All DLL1 Products
Required fields are marked with *