Recombinant Human DLX6 Protein, GST-tagged

Cat.No. : DLX6-2697H
Product Overview : Human DLX6 full-length ORF ( AAH69363.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. [provided by RefSeq, Jul 2008]
Molecular Mass : 46.1 kDa
AA Sequence : MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DLX6 distal-less homeobox 6 [ Homo sapiens ]
Official Symbol DLX6
Synonyms DLX6; distal-less homeobox 6; distal less homeo box 6; homeobox protein DLX-6; distal-less homeo box 6; MGC125282; MGC125283; MGC125284; MGC125285;
Gene ID 1750
mRNA Refseq NM_005222
Protein Refseq NP_005213
MIM 600030
UniProt ID P56179

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DLX6 Products

Required fields are marked with *

My Review for All DLX6 Products

Required fields are marked with *

0
cart-icon