Recombinant Human DLX6 protein, GST-tagged

• Cat.No.: DLX6-301124H
• Product Overview: Recombinant Human DLX6 (110-175 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Gln110-Met175
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: QGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: DLX6 distal-less homeobox 6 [ Homo sapiens ]
• Official Symbol: DLX6
• Synonyms: DLX6; distal-less homeobox 6; distal less homeo box 6; homeobox protein DLX-6; distal-less homeo box 6; MGC125282; MGC125283; MGC125284; MGC125285
• Gene ID: 1750
• mRNA Refseq: NM_005222
• Protein Refseq: NP_005213
• MIM: 600030
• UniProt ID: P56179