Recombinant Human DMAP1 Protein, GST-tagged

Cat.No. : DMAP1-2699H
Product Overview : Human DMAP1 partial ORF ( NP_061973, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a subunit of several, distinct complexes involved in the repression or activation of transcription. The encoded protein can independently repress transcription and is targeted to replication foci throughout S phase by interacting directly with the N-terminus of DNA methyltransferase 1. During late S phase, histone deacetylase 2 is added to this complex, providing a means to deacetylate histones in transcriptionally inactive heterochromatin following replication. The encoded protein is also a component of the nucleosome acetyltransferase of H4 complex and interacts with the transcriptional corepressor tumor susceptibility gene 101 and the pro-apoptotic death-associated protein 6, among others. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DMAP1 DNA methyltransferase 1 associated protein 1 [ Homo sapiens ]
Official Symbol DMAP1
Synonyms DMAP1; DNA methyltransferase 1 associated protein 1; DNA methyltransferase 1-associated protein 1; DNMAP1; DNMTAP1; EAF2; FLJ11543; KIAA1425; MEAF2; SWC4; DNMT1 associated protein 1; DNMT1-associated protein 1; DKFZp686L09142;
Gene ID 55929
mRNA Refseq NM_001034024
Protein Refseq NP_001029196
MIM 605077
UniProt ID Q9NPF5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DMAP1 Products

Required fields are marked with *

My Review for All DMAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon