Recombinant Human DMBT1 Protein, GST-tagged
Cat.No. : | DMBT1-2700H |
Product Overview : | Human DMBT1 partial ORF ( NP_004397, 1377 a.a. - 1485 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. This gene was originally isolated based on its deletion in a medulloblastoma cell line. This gene is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The encoded protein precursor is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor suppressor gene, but rather play a role in the interaction of tumor cells and the immune system. [provided by RefSeq, Mar 2016] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | DYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEVQNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGARGSFTSSSNFMSIRFISDHSITRRRFRAE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DMBT1 deleted in malignant brain tumors 1 [ Homo sapiens ] |
Official Symbol | DMBT1 |
Synonyms | DMBT1; deleted in malignant brain tumors 1; deleted in malignant brain tumors 1 protein; GP340; muclin; SAG; gp-340; hensin; glycoprotein 340; salivary agglutinin; surfactant pulmonary-associated D-binding protein; FLJ61058; MGC164738; |
Gene ID | 1755 |
mRNA Refseq | NM_004406 |
Protein Refseq | NP_004397 |
MIM | 601969 |
UniProt ID | Q9UGM3 |
◆ Recombinant Proteins | ||
DMBT1-2700H | Recombinant Human DMBT1 Protein, GST-tagged | +Inquiry |
DMBT1-1890R | Recombinant Rat DMBT1 Protein | +Inquiry |
DMBT1-3231H | Recombinant Human DMBT1 protein(Met1-Ser220), His-tagged | +Inquiry |
DMBT1-1549R | Recombinant Rat DMBT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DMBT1-26786TH | Recombinant Human DMBT1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DMBT1-2407HCL | Recombinant Human DMBT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DMBT1 Products
Required fields are marked with *
My Review for All DMBT1 Products
Required fields are marked with *
0
Inquiry Basket