Recombinant Human DMRTC2 Protein, GST-tagged
| Cat.No. : | DMRTC2-2716H |
| Product Overview : | Human DMRTC2 full-length ORF (BAB71473.1, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DMRTC2 (DMRT Like Family C2) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is DMRTC1. |
| Molecular Mass : | 50.7 kDa |
| AA Sequence : | MEPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVTAHLKGHKRLCLSQACECHKCVHILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQPQVPSGKENIAPQPQTPHGAVLLAPTPPGKPCTQLQPVPSAPAELLWASAAQPSPGSLALVLDSGASWPLGPWTLAASRLLHATTSGVPPAVPRTCCLSASLPWL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DMRTC2 DMRT-like family C2 [ Homo sapiens ] |
| Official Symbol | DMRTC2 |
| Synonyms | DMRTC2; DMRT-like family C2; doublesex- and mab-3-related transcription factor C2; |
| Gene ID | 63946 |
| mRNA Refseq | NM_001040283 |
| Protein Refseq | NP_001035373 |
| MIM | 614806 |
| UniProt ID | Q8IXT2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DMRTC2 Products
Required fields are marked with *
My Review for All DMRTC2 Products
Required fields are marked with *
Recently Viewed
