Recombinant Human DMTF1 Protein, GST-tagged
Cat.No. : | DMTF1-2717H |
Product Overview : | Human DMTF1 partial ORF ( NP_066968, 661 a.a. - 760 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | KQEESPSDLASAYVTEGLESPTIEEQVDQTIDDETILIVPSPHGFIQASDVIDTESVLPLTTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DMTF1 cyclin D binding myb-like transcription factor 1 [ Homo sapiens ] |
Official Symbol | DMTF1 |
Synonyms | DMTF1; cyclin D binding myb-like transcription factor 1; cyclin-D-binding Myb-like transcription factor 1; cyclin D binding Myb like protein; DMP1; DMTF; hDMP1; hDMTF1; cyclin D-binding Myb-like protein; cyclin-D-interacting Myb-like protein 1; FLJ25188; FLJ41265; FLJ76054; |
Gene ID | 9988 |
mRNA Refseq | NM_001142326 |
Protein Refseq | NP_001135798 |
MIM | 608491 |
UniProt ID | Q9Y222 |
◆ Recombinant Proteins | ||
DMTF1-1893R | Recombinant Rat DMTF1 Protein | +Inquiry |
DMTF1-4660M | Recombinant Mouse DMTF1 Protein | +Inquiry |
DMTF1-2717H | Recombinant Human DMTF1 Protein, GST-tagged | +Inquiry |
DMTF1-1108R | Recombinant Rhesus Macaque DMTF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DMTF1-2422M | Recombinant Mouse DMTF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DMTF1 Products
Required fields are marked with *
My Review for All DMTF1 Products
Required fields are marked with *