Recombinant Human DMTF1 Protein, GST-tagged

Cat.No. : DMTF1-2717H
Product Overview : Human DMTF1 partial ORF ( NP_066968, 661 a.a. - 760 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]
Molecular Mass : 36.74 kDa
AA Sequence : KQEESPSDLASAYVTEGLESPTIEEQVDQTIDDETILIVPSPHGFIQASDVIDTESVLPLTTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DMTF1 cyclin D binding myb-like transcription factor 1 [ Homo sapiens ]
Official Symbol DMTF1
Synonyms DMTF1; cyclin D binding myb-like transcription factor 1; cyclin-D-binding Myb-like transcription factor 1; cyclin D binding Myb like protein; DMP1; DMTF; hDMP1; hDMTF1; cyclin D-binding Myb-like protein; cyclin-D-interacting Myb-like protein 1; FLJ25188; FLJ41265; FLJ76054;
Gene ID 9988
mRNA Refseq NM_001142326
Protein Refseq NP_001135798
MIM 608491
UniProt ID Q9Y222

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DMTF1 Products

Required fields are marked with *

My Review for All DMTF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon