"DNAJB1" Related Products

Expand
Expand

Recombinant Human DNAJB1 Protein, GST-tagged

Cat.No.: DNAJB1-2730H
Product Overview: Human DNAJB1 full-length ORF ( AAH19827, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 63.14 kDa
AA Sequence: MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: DNAJB1 DnaJ (Hsp40) homolog, subfamily B, member 1 [ Homo sapiens ]
Official Symbol: DNAJB1
Synonyms: DNAJB1; DnaJ (Hsp40) homolog, subfamily B, member 1; HSPF1; dnaJ homolog subfamily B member 1; Hsp40; radial spoke 16 homolog B (Chlamydomonas); RSPH16B; Sis1; hDj-1; human DnaJ protein 1; heat shock protein 40; dnaJ protein homolog 1; heat shock 40kD protein 1; radial spoke 16 homolog B; heat shock 40 kDa protein 1; DnaJ (Hsp40) homolog, subfmaily B, member 1; Hdj1;
Gene ID: 3337
mRNA Refseq: NM_006145
Protein Refseq: NP_006136
MIM: 604572
UniProt ID: P25685

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.