Recombinant Human DNAJB11, His-tagged
Cat.No. : | DNAJB11-28367TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 44-358 of Human DNAJB11 with an N terminal His tag. Predicted mwt: 37 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 44-358 a.a. |
Description : | DNAJB11 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. |
Conjugation : | HIS |
Tissue specificity : | Widely expressed. |
Form : | Lyophilised:Reconstitute with 107 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKR KQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTP RQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVAR QAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNV KLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPG DLRFRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDI THLDGHKVHISRDKITRPGAKLWKKGEGLPNFDNNNIK GSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYN GLQGY |
Sequence Similarities : | Contains 1 J domain. |
Gene Name | DNAJB11 DnaJ (Hsp40) homolog, subfamily B, member 11 [ Homo sapiens ] |
Official Symbol | DNAJB11 |
Synonyms | DNAJB11; DnaJ (Hsp40) homolog, subfamily B, member 11; dnaJ homolog subfamily B member 11; EDJ; ERdj3; HEDJ; |
Gene ID | 51726 |
mRNA Refseq | NM_016306 |
Protein Refseq | NP_057390 |
MIM | 611341 |
Uniprot ID | Q9UBS4 |
Chromosome Location | 3q27 |
Pathway | Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; Unfolded Protein Response, organism-specific biosystem; |
Function | heat shock protein binding; unfolded protein binding; |
◆ Recombinant Proteins | ||
DNAJB11-3960HF | Recombinant Full Length Human DNAJB11 Protein, GST-tagged | +Inquiry |
DNAJB11-2645H | Recombinant Human DNAJB11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DNAJB11-12059H | Recombinant Human DNAJB11, His-tagged | +Inquiry |
DNAJB11-9855Z | Recombinant Zebrafish DNAJB11 | +Inquiry |
DNAJB11-28366TH | Recombinant Human DNAJB11, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJB11-6891HCL | Recombinant Human DNAJB11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJB11 Products
Required fields are marked with *
My Review for All DNAJB11 Products
Required fields are marked with *