Recombinant Human DNAJB8, His-tagged
| Cat.No. : | DNAJB8-26156TH |
| Product Overview : | Recombinant full-length Human DNAJB8 (amino acids 1-232) with a N terminal His tag; 252 amino acids with a predicted MWt 27.8 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 232 amino acids |
| Description : | DNAJB8 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. |
| Conjugation : | HIS |
| Molecular Weight : | 27.800kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMANYYEVLGVQASASPEDIK KAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSK KRSLYDRAGCDSWRAGGGASTPYHSPFDTGYTFRNPEDIF REFFGGLDPFSFEFWDSPFNSDRGGRGHGLRGAFSAGFGE FPAFMEAFSSFNMLGCSGGSHTTFSSTSFGGSSSGSSGFK SVMSSTEMINGHKVTTKRIVENGQERVEVEEDGQLKSVTV NGKEQLKWMDSK |
| Sequence Similarities : | Contains 1 J domain. |
| Gene Name | DNAJB8 DnaJ (Hsp40) homolog, subfamily B, member 8 [ Homo sapiens ] |
| Official Symbol | DNAJB8 |
| Synonyms | DNAJB8; DnaJ (Hsp40) homolog, subfamily B, member 8; dnaJ homolog subfamily B member 8; MGC33884; |
| Gene ID | 165721 |
| mRNA Refseq | NM_153330 |
| Protein Refseq | NP_699161 |
| MIM | 611337 |
| Uniprot ID | Q8NHS0 |
| Chromosome Location | 3q21.3 |
| Function | heat shock protein binding; unfolded protein binding; |
| ◆ Recombinant Proteins | ||
| DNAJB8-392H | Recombinant Human DNAJB8 Protein, GST-tagged | +Inquiry |
| DNAJB8-6898H | Recombinant Human DnaJ (Hsp40) Homolog, Subfamily B, Member 8, His-tagged | +Inquiry |
| DNAJB8-2743H | Recombinant Human DNAJB8 Protein, GST-tagged | +Inquiry |
| DNAJB8-4730H | Recombinant Human DNAJB8, His-tagged | +Inquiry |
| DNAJB8-3986HF | Recombinant Full Length Human DNAJB8 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNAJB8-494HCL | Recombinant Human DNAJB8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJB8 Products
Required fields are marked with *
My Review for All DNAJB8 Products
Required fields are marked with *
