Recombinant Human DNAJB9 Protein, GST-tagged
Cat.No. : | DNAJB9-2744H |
Product Overview : | Human DNAJB9 full-length ORF ( NP_036460.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized to the endoplasmic reticulum. This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis. [provided by RefSeq, Dec 2010] |
Molecular Mass : | 51.9 kDa |
AA Sequence : | MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DNAJB9 DnaJ (Hsp40) homolog, subfamily B, member 9 [ Homo sapiens ] |
Official Symbol | DNAJB9 |
Synonyms | DNAJB9; DnaJ (Hsp40) homolog, subfamily B, member 9; MDG1; dnaJ homolog subfamily B member 9; endoplasmic reticulum DnaJ homolog 4; microvascular endothelial differentiation gene 1 protein; ERdj4; MDG-1; MST049; MSTP049; DKFZp564F1862; |
Gene ID | 4189 |
mRNA Refseq | NM_012328 |
Protein Refseq | NP_036460 |
MIM | 602634 |
UniProt ID | Q9UBS3 |
◆ Recombinant Proteins | ||
DNAJB9-1287R | Recombinant Rhesus monkey DNAJB9 Protein, His-tagged | +Inquiry |
DNAJB9-1112R | Recombinant Rhesus Macaque DNAJB9 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJB9-2744H | Recombinant Human DNAJB9 Protein, GST-tagged | +Inquiry |
DNAJB9-2436C | Recombinant Chicken DNAJB9 | +Inquiry |
DNAJB9-1903R | Recombinant Rat DNAJB9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJB9-6881HCL | Recombinant Human DNAJB9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJB9 Products
Required fields are marked with *
My Review for All DNAJB9 Products
Required fields are marked with *