Recombinant Human DNAJB9 Protein, GST-tagged

Cat.No. : DNAJB9-2744H
Product Overview : Human DNAJB9 full-length ORF ( NP_036460.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized to the endoplasmic reticulum. This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis. [provided by RefSeq, Dec 2010]
Molecular Mass : 51.9 kDa
AA Sequence : MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNAJB9 DnaJ (Hsp40) homolog, subfamily B, member 9 [ Homo sapiens ]
Official Symbol DNAJB9
Synonyms DNAJB9; DnaJ (Hsp40) homolog, subfamily B, member 9; MDG1; dnaJ homolog subfamily B member 9; endoplasmic reticulum DnaJ homolog 4; microvascular endothelial differentiation gene 1 protein; ERdj4; MDG-1; MST049; MSTP049; DKFZp564F1862;
Gene ID 4189
mRNA Refseq NM_012328
Protein Refseq NP_036460
MIM 602634
UniProt ID Q9UBS3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAJB9 Products

Required fields are marked with *

My Review for All DNAJB9 Products

Required fields are marked with *

0
cart-icon
0
compare icon