Recombinant Human DNAJC15 Protein, GST-tagged
| Cat.No. : | DNAJC15-2752H |
| Product Overview : | Human DNAJD1 full-length ORF ( AAH10910, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DNAJC15 (DnaJ Heat Shock Protein Family (Hsp40) Member C15) is a Protein Coding gene. Diseases associated with DNAJC15 include Cicatricial Entropion. An important paralog of this gene is DNAJC19. |
| Molecular Mass : | 42.24 kDa |
| AA Sequence : | MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQGLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DNAJC15 DnaJ (Hsp40) homolog, subfamily C, member 15 [ Homo sapiens ] |
| Official Symbol | DNAJC15 |
| Synonyms | DNAJC15; DnaJ (Hsp40) homolog, subfamily C, member 15; DnaJ (Hsp40) homolog, subfamily D, member 1 , DNAJD1; dnaJ homolog subfamily C member 15; MCJ; DNAJ domain-containing; methylation-controlled J protein; cell growth-inhibiting gene 22 protein; DnaJ (Hsp40) homolog, subfamily D, member 1; HSD18; DNAJD1; |
| Gene ID | 29103 |
| mRNA Refseq | NM_013238 |
| Protein Refseq | NP_037370 |
| MIM | 615339 |
| UniProt ID | Q9Y5T4 |
| ◆ Recombinant Proteins | ||
| DNAJC15-5138C | Recombinant Chicken DNAJC15 | +Inquiry |
| DNAJC15-3997HF | Recombinant Full Length Human DNAJC15 Protein, GST-tagged | +Inquiry |
| RFL12587XF | Recombinant Full Length Xenopus Tropicalis Dnaj Homolog Subfamily C Member 15(Dnajc15) Protein, His-Tagged | +Inquiry |
| DNAJC15-2752H | Recombinant Human DNAJC15 Protein, GST-tagged | +Inquiry |
| RFL25781PF | Recombinant Full Length Pongo Abelii Dnaj Homolog Subfamily C Member 15(Dnajc15) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNAJC15-6878HCL | Recombinant Human DNAJC15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJC15 Products
Required fields are marked with *
My Review for All DNAJC15 Products
Required fields are marked with *
