Recombinant Human DNAJC19 Protein, His-tagged
Cat.No. : | DNAJC19-2756H |
Product Overview : | Human DNAJC19 (NP_660304, 19 a.a. - 116 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-116 a.a. |
Description : | The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 2, 6, 10, 14 and 19. [provided by RefSeq, Jan 2012] |
Form : | Liquid |
Molecular Mass : | 15.1 kDa |
AA Sequence : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK |
Purity : | > 90% by SDS - PAGE |
Applications : | SDS-PAGE |
Storage : | Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | 1 mg/mL |
Storage Buffer : | In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (2 mM dithiothreitol, 10% glycerol) |
Gene Name | DNAJC19 DnaJ (Hsp40) homolog, subfamily C, member 19 [ Homo sapiens ] |
Official Symbol | DNAJC19 |
Synonyms | DNAJC19; DnaJ (Hsp40) homolog, subfamily C, member 19; mitochondrial import inner membrane translocase subunit TIM14; Pam18; Tim14; TIMM14; homolog of yeast TIM14; PAM18; TIM14; FLJ99060; |
Gene ID | 131118 |
mRNA Refseq | NM_001190233 |
Protein Refseq | NP_001177162 |
MIM | 608977 |
UniProt ID | Q96DA6 |
◆ Recombinant Proteins | ||
DNAJC19-12079H | Recombinant Human DNAJC19, GST-tagged | +Inquiry |
DNAJC19-1290R | Recombinant Rhesus monkey DNAJC19 Protein, His-tagged | +Inquiry |
DNAJC19-2756H | Recombinant Human DNAJC19 Protein, His-tagged | +Inquiry |
DNAJC19-11024Z | Recombinant Zebrafish DNAJC19 | +Inquiry |
DNAJC19-1115R | Recombinant Rhesus Macaque DNAJC19 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJC19-6875HCL | Recombinant Human DNAJC19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNAJC19 Products
Required fields are marked with *
My Review for All DNAJC19 Products
Required fields are marked with *
0
Inquiry Basket