Recombinant Human DNAJC19 Protein, His-tagged

Cat.No. : DNAJC19-2756H
Product Overview : Human DNAJC19 (NP_660304, 19 a.a. - 116 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 19-116 a.a.
Description : The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutaconic aciduria type 5 (MGA5), also known as dilated cardiomyopathy with ataxia (DCMA). Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 2, 6, 10, 14 and 19. [provided by RefSeq, Jan 2012]
Form : Liquid
Molecular Mass : 15.1 kDa
AA Sequence : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Purity : > 90% by SDS - PAGE
Applications : SDS-PAGE
Storage : Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : 1 mg/mL
Storage Buffer : In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (2 mM dithiothreitol, 10% glycerol)
Gene Name DNAJC19 DnaJ (Hsp40) homolog, subfamily C, member 19 [ Homo sapiens ]
Official Symbol DNAJC19
Synonyms DNAJC19; DnaJ (Hsp40) homolog, subfamily C, member 19; mitochondrial import inner membrane translocase subunit TIM14; Pam18; Tim14; TIMM14; homolog of yeast TIM14; PAM18; TIM14; FLJ99060;
Gene ID 131118
mRNA Refseq NM_001190233
Protein Refseq NP_001177162
MIM 608977
UniProt ID Q96DA6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAJC19 Products

Required fields are marked with *

My Review for All DNAJC19 Products

Required fields are marked with *

0
cart-icon