Recombinant Human DNAJC22 Protein, GST-tagged
| Cat.No. : | DNAJC22-4243H | 
| Product Overview : | Human FLJ13236 full-length ORF ( NP_079178.2, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | DNAJC22 (DnaJ Heat Shock Protein Family (Hsp40) Member C22) is a Protein Coding gene. Diseases associated with DNAJC22 include Leukoencephalopathy With Vanishing White Matter. GO annotations related to this gene include unfolded protein binding and chaperone binding. | 
| Molecular Mass : | 64.5 kDa | 
| AA Sequence : | MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQANRAQGQRQSPRGVTPPLSPIRFAAQVIVGIYFGLVALISLSSMVNFYIVALPLAVGLGVLLVAAVGNQTSDFKNTLGSAFLTSPIFYGRPIAILPISVAASITAQRHRRYKALVASEPLSVRLYRLGLAYLAFTGPLAYSALCNTAATLSYVAETFGSFLNWFSFFPLLGRLMEFVLLLPYRIWRLLMGETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPWGSRR | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | DNAJC22 DnaJ (Hsp40) homolog, subfamily C, member 22 [ Homo sapiens ] | 
| Official Symbol | DNAJC22 | 
| Synonyms | DNAJC22; DnaJ (Hsp40) homolog, subfamily C, member 22; dnaJ homolog subfamily C member 22; FLJ13236; wurst homolog (Drosophila); wus; wurst homolog; | 
| Gene ID | 79962 | 
| mRNA Refseq | NM_024902 | 
| Protein Refseq | NP_079178 | 
| UniProt ID | Q8N4W6 | 
| ◆ Recombinant Proteins | ||
| RFL909XF | Recombinant Full Length Xenopus Tropicalis Dnaj Homolog Subfamily C Member 22(Dnajc22) Protein, His-Tagged | +Inquiry | 
| DNAJC22-1909R | Recombinant Rat DNAJC22 Protein | +Inquiry | 
| DNAJC22-4709M | Recombinant Mouse DNAJC22 Protein | +Inquiry | 
| RFL9197HF | Recombinant Full Length Human Dnaj Homolog Subfamily C Member 22(Dnajc22) Protein, His-Tagged | +Inquiry | 
| DNAJC22-2451M | Recombinant Mouse DNAJC22 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DNAJC22-632HCL | Recombinant Human DNAJC22 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All DNAJC22 Products
Required fields are marked with *
My Review for All DNAJC22 Products
Required fields are marked with *
  
        
    
      
            