Recombinant Human DNAJC9 Protein, MYC/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DNAJC9-426H | 
| Product Overview : | DNAJC9 MS Standard C13 and N15-labeled recombinant protein (NP_056005) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | May play a role as co-chaperone of the Hsp70 family proteins HSPA1A, HSPA1B and HSPA8. | 
| Molecular Mass : | 30.4 kDa | 
| AA Sequence : | MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | DNAJC9 DnaJ (Hsp40) homolog, subfamily C, member 9 [ Homo sapiens (human) ] | 
| Official Symbol | DNAJC9 | 
| Synonyms | DNAJC9; DnaJ (Hsp40) homolog, subfamily C, member 9; dnaJ homolog subfamily C member 9; JDD1; SB73; DnaJ protein SB73; HDJC9; KIAA0974; | 
| Gene ID | 23234 | 
| mRNA Refseq | NM_015190 | 
| Protein Refseq | NP_056005 | 
| MIM | 611206 | 
| UniProt ID | Q8WXX5 | 
| ◆ Recombinant Proteins | ||
| DNAJC9-2458M | Recombinant Mouse DNAJC9 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| DNAJC9-2770H | Recombinant Human DNAJC9 Protein, GST-tagged | +Inquiry | 
| DNAJC9-4363C | Recombinant Chicken DNAJC9 | +Inquiry | 
| DNAJC9-426H | Recombinant Human DNAJC9 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| DNAJC9-4722M | Recombinant Mouse DNAJC9 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DNAJC9-6869HCL | Recombinant Human DNAJC9 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All DNAJC9 Products
Required fields are marked with *
My Review for All DNAJC9 Products
Required fields are marked with *
  
        
    
      
            