Recombinant Human DNAJC9 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : DNAJC9-426H
Product Overview : DNAJC9 MS Standard C13 and N15-labeled recombinant protein (NP_056005) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : May play a role as co-chaperone of the Hsp70 family proteins HSPA1A, HSPA1B and HSPA8.
Molecular Mass : 30.4 kDa
AA Sequence : MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DNAJC9 DnaJ (Hsp40) homolog, subfamily C, member 9 [ Homo sapiens (human) ]
Official Symbol DNAJC9
Synonyms DNAJC9; DnaJ (Hsp40) homolog, subfamily C, member 9; dnaJ homolog subfamily C member 9; JDD1; SB73; DnaJ protein SB73; HDJC9; KIAA0974;
Gene ID 23234
mRNA Refseq NM_015190
Protein Refseq NP_056005
MIM 611206
UniProt ID Q8WXX5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAJC9 Products

Required fields are marked with *

My Review for All DNAJC9 Products

Required fields are marked with *

0
cart-icon
0
compare icon