Recombinant Human DNAJC9 Protein, MYC/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DNAJC9-426H |
| Product Overview : | DNAJC9 MS Standard C13 and N15-labeled recombinant protein (NP_056005) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | May play a role as co-chaperone of the Hsp70 family proteins HSPA1A, HSPA1B and HSPA8. |
| Molecular Mass : | 30.4 kDa |
| AA Sequence : | MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | DNAJC9 DnaJ (Hsp40) homolog, subfamily C, member 9 [ Homo sapiens (human) ] |
| Official Symbol | DNAJC9 |
| Synonyms | DNAJC9; DnaJ (Hsp40) homolog, subfamily C, member 9; dnaJ homolog subfamily C member 9; JDD1; SB73; DnaJ protein SB73; HDJC9; KIAA0974; |
| Gene ID | 23234 |
| mRNA Refseq | NM_015190 |
| Protein Refseq | NP_056005 |
| MIM | 611206 |
| UniProt ID | Q8WXX5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJC9 Products
Required fields are marked with *
My Review for All DNAJC9 Products
Required fields are marked with *




