Recombinant Human DNAJC9 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | DNAJC9-426H |
Product Overview : | DNAJC9 MS Standard C13 and N15-labeled recombinant protein (NP_056005) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May play a role as co-chaperone of the Hsp70 family proteins HSPA1A, HSPA1B and HSPA8. |
Molecular Mass : | 30.4 kDa |
AA Sequence : | MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DNAJC9 DnaJ (Hsp40) homolog, subfamily C, member 9 [ Homo sapiens (human) ] |
Official Symbol | DNAJC9 |
Synonyms | DNAJC9; DnaJ (Hsp40) homolog, subfamily C, member 9; dnaJ homolog subfamily C member 9; JDD1; SB73; DnaJ protein SB73; HDJC9; KIAA0974; |
Gene ID | 23234 |
mRNA Refseq | NM_015190 |
Protein Refseq | NP_056005 |
MIM | 611206 |
UniProt ID | Q8WXX5 |
◆ Recombinant Proteins | ||
DNAJC9-566Z | Recombinant Zebrafish DNAJC9 | +Inquiry |
DNAJC9-426H | Recombinant Human DNAJC9 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
DNAJC9-2770H | Recombinant Human DNAJC9 Protein, GST-tagged | +Inquiry |
DNAJC9-4026HF | Recombinant Full Length Human DNAJC9 Protein, GST-tagged | +Inquiry |
DNAJC9-26775TH | Recombinant Human DNAJC9, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJC9-6869HCL | Recombinant Human DNAJC9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAJC9 Products
Required fields are marked with *
My Review for All DNAJC9 Products
Required fields are marked with *