Recombinant Human DNAL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DNAL1-6397H
Product Overview : DNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_113615) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. Alternate splicing results in multiple transcript variants.
Molecular Mass : 17.1 kDa
AA Sequence : MDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DNAL1 dynein axonemal light chain 1 [ Homo sapiens (human) ]
Official Symbol DNAL1
Synonyms axonemal; Axonemal dynein light chain 1; Axonemal dynein light chain; C14orf168; Chromosome 14 open reading frame 168; CILD16; DNAL 1; dnal1; DNAL1_HUMAN; Dynein axonemal light chain 1; Dynein light chain 1; Dynein light chain 1 axonemal; MGC12435;
Gene ID 83544
mRNA Refseq NM_031427
Protein Refseq NP_113615
MIM 610062
UniProt ID Q4LDG9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAL1 Products

Required fields are marked with *

My Review for All DNAL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon