Recombinant Human DNAL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DNAL1-6397H |
Product Overview : | DNAL1 MS Standard C13 and N15-labeled recombinant protein (NP_113615) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 17.1 kDa |
AA Sequence : | MDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DNAL1 dynein axonemal light chain 1 [ Homo sapiens (human) ] |
Official Symbol | DNAL1 |
Synonyms | axonemal; Axonemal dynein light chain 1; Axonemal dynein light chain; C14orf168; Chromosome 14 open reading frame 168; CILD16; DNAL 1; dnal1; DNAL1_HUMAN; Dynein axonemal light chain 1; Dynein light chain 1; Dynein light chain 1 axonemal; MGC12435; |
Gene ID | 83544 |
mRNA Refseq | NM_031427 |
Protein Refseq | NP_113615 |
MIM | 610062 |
UniProt ID | Q4LDG9 |
◆ Recombinant Proteins | ||
DNAL1-2771H | Recombinant Human DNAL1 Protein, GST-tagged | +Inquiry |
DNAL1-6397H | Recombinant Human DNAL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DNAL1-4455C | Recombinant Chicken DNAL1 | +Inquiry |
DNAL1-4027HF | Recombinant Full Length Human DNAL1 Protein, GST-tagged | +Inquiry |
DNAL1-12091H | Recombinant Human DNAL1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAL1-228HCL | Recombinant Human DNAL1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAL1 Products
Required fields are marked with *
My Review for All DNAL1 Products
Required fields are marked with *