Recombinant Human DNASE1L3 Full Length protein, His-tagged
| Cat.No. : | DNASE1L3-29H |
| Product Overview : | Recombinant Human DNASE1L3 Full Length protein(Q13609), fused with N-terminal His tag, was expressed in Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 35.8 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS |
| Gene Name | DNASE1L3 deoxyribonuclease 1 like 3 [ Homo sapiens (human) ] |
| Official Symbol | DNASE1L3 |
| Synonyms | Deoxyribonuclease gamma; Deoxyribonuclease I like 3; Deoxyribonuclease I like III; Deoxyribonuclease I-like 3; DHP 2; DHP2; DNAS1L3; DNase gamma; DNase I homolog protein 2; DNase I homolog protein DHP2; DNase I like 3; DNase I-like 3; DNASE1L3; DNSL3_HUMAN; Liver and spleen DNase; LS DNase; LS-DNase; LSD; SLEB 16; SLEB16 |
| Gene ID | 1776 |
| mRNA Refseq | NM_001256560 |
| Protein Refseq | NP_001243489 |
| MIM | 602244 |
| UniProt ID | Q13609 |
| ◆ Recombinant Proteins | ||
| DNASE1L3-13HFL | Recombinant Human DNASE1L3 Protein, Full Length, N-GST and C-His tagged | +Inquiry |
| DNASE1L3-2964H | Recombinant Human DNASE1L3 protein, His-tagged | +Inquiry |
| DNASE1L3-26157TH | Recombinant Human DNASE1L3 | +Inquiry |
| DNASE1L3-29H | Recombinant Human DNASE1L3 Full Length protein, His-tagged | +Inquiry |
| DNASE1L3-622H | Recombinant Human Deoxyribonuclease I-like 3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNASE1L3-6864HCL | Recombinant Human DNASE1L3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNASE1L3 Products
Required fields are marked with *
My Review for All DNASE1L3 Products
Required fields are marked with *
