Recombinant Human DNASE1L3 protein
Cat.No. : | DNASE1L3-4417H |
Product Overview : | Recombinant Human DNASE1L3 protein(Q13609)(21-305aa), was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 21-305aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.4 kDa |
AA Sequence : | MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | DNASE1L3 deoxyribonuclease I-like 3 [ Homo sapiens ] |
Official Symbol | DNASE1L3 |
Synonyms | DNASE1L3; deoxyribonuclease I-like 3; deoxyribonuclease gamma; DNAS1L3; DNase gamma; LSD; LS-DNase; DNase I-like 3; Liver and spleen DNase; DNase I homolog protein 2; DNase I homolog protein DHP2; deoxyribonuclease I-like III; DHP2; SLEB16; |
Gene ID | 1776 |
mRNA Refseq | NM_001256560 |
Protein Refseq | NP_001243489 |
MIM | 602244 |
UniProt ID | Q13609 |
◆ Recombinant Proteins | ||
DNASE1L3-4219H | Recombinant Human DNASE1L3 protein, His&Myc-tagged | +Inquiry |
DNASE1L3-1004HF | Recombinant Full Length Human DNASE1L3 Protein, GST-tagged | +Inquiry |
DNASE1L3-4729M | Recombinant Mouse DNASE1L3 Protein | +Inquiry |
DNASE1L3-3273C | Recombinant Chicken DNASE1L3 | +Inquiry |
DNASE1L3-5853H | Recombinant Human DNASE1L3 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNASE1L3-6864HCL | Recombinant Human DNASE1L3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNASE1L3 Products
Required fields are marked with *
My Review for All DNASE1L3 Products
Required fields are marked with *