Recombinant Human DNASE1L3 protein
| Cat.No. : | DNASE1L3-4417H |
| Product Overview : | Recombinant Human DNASE1L3 protein(Q13609)(21-305aa), was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 21-305aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.4 kDa |
| AA Sequence : | MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | DNASE1L3 deoxyribonuclease I-like 3 [ Homo sapiens ] |
| Official Symbol | DNASE1L3 |
| Synonyms | DNASE1L3; deoxyribonuclease I-like 3; deoxyribonuclease gamma; DNAS1L3; DNase gamma; LSD; LS-DNase; DNase I-like 3; Liver and spleen DNase; DNase I homolog protein 2; DNase I homolog protein DHP2; deoxyribonuclease I-like III; DHP2; SLEB16; |
| Gene ID | 1776 |
| mRNA Refseq | NM_001256560 |
| Protein Refseq | NP_001243489 |
| MIM | 602244 |
| UniProt ID | Q13609 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNASE1L3 Products
Required fields are marked with *
My Review for All DNASE1L3 Products
Required fields are marked with *
