Recombinant Human DNASE1L3 Protein, His-tagged
Cat.No. : | DNASE1L3-2790H |
Product Overview : | Recombinant Human DNASE1L3 Protein is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 35.8 kDa |
AA Sequence : | MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Full Length : | Full L. |
Gene Name | DNASE1L3 deoxyribonuclease I-like 3 [ Homo sapiens ] |
Official Symbol | DNASE1L3 |
Synonyms | DNASE1L3; deoxyribonuclease I-like 3; DNAS1L3; DNase gamma; LSD; LS-DNase; DNase I-like 3; Liver and spleen DNase; DHP2; SLEB16; |
Gene ID | 1776 |
mRNA Refseq | NM_001256560 |
Protein Refseq | NP_001243489 |
MIM | 602244 |
UniProt ID | Q13609 |
◆ Recombinant Proteins | ||
DNASE1L3-4729M | Recombinant Mouse DNASE1L3 Protein | +Inquiry |
DNASE1L3-4219H | Recombinant Human DNASE1L3 protein, His&Myc-tagged | +Inquiry |
DNASE1L3-622H | Recombinant Human Deoxyribonuclease I-like 3 | +Inquiry |
DNASE1L3-2964H | Recombinant Human DNASE1L3 protein, His-tagged | +Inquiry |
DNASE1L3-3273C | Recombinant Chicken DNASE1L3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNASE1L3-6864HCL | Recombinant Human DNASE1L3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNASE1L3 Products
Required fields are marked with *
My Review for All DNASE1L3 Products
Required fields are marked with *
0
Inquiry Basket