"DNASE1L3" Related Products

Expand
Expand
Expand

Recombinant Human DNASE1L3 Protein, His-tagged

Cat.No. : DNASE1L3-2790H
Product Overview : Recombinant Human DNASE1L3 Protein is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.
Source : Baculovirus
Species : Human
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 35.8 kDa
AA Sequence : MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name : DNASE1L3 deoxyribonuclease I-like 3 [ Homo sapiens ]
Official Symbol : DNASE1L3
Synonyms : DNASE1L3; deoxyribonuclease I-like 3; DNAS1L3; DNase gamma; LSD; LS-DNase; DNase I-like 3; Liver and spleen DNase; DHP2; SLEB16;
Gene ID : 1776
mRNA Refseq : NM_001256560
Protein Refseq : NP_001243489
MIM : 602244
UniProt ID : Q13609

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.