Recombinant Human DNASE1L3 Protein, His-tagged
| Cat.No. : | DNASE1L3-2790H |
| Product Overview : | Recombinant Human DNASE1L3 Protein is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 35.8 kDa |
| AA Sequence : | MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Full Length : | Full L. |
| Gene Name | DNASE1L3 deoxyribonuclease I-like 3 [ Homo sapiens ] |
| Official Symbol | DNASE1L3 |
| Synonyms | DNASE1L3; deoxyribonuclease I-like 3; DNAS1L3; DNase gamma; LSD; LS-DNase; DNase I-like 3; Liver and spleen DNase; DHP2; SLEB16; |
| Gene ID | 1776 |
| mRNA Refseq | NM_001256560 |
| Protein Refseq | NP_001243489 |
| MIM | 602244 |
| UniProt ID | Q13609 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNASE1L3 Products
Required fields are marked with *
My Review for All DNASE1L3 Products
Required fields are marked with *



