Recombinant Human DNMT3L

Cat.No. : DNMT3L-26950TH
Product Overview : Recombinant fragment corresponding to aa 288-387 of human Dnmt3L with a proprietary tag; 36.63kDa inclusive of tag;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a nuclear protein with similarity to DNA methyltransferases. This protein is not thought to function as a DNA methyltransferase as it does not contain the amino acid residues necessary for methyltransferase activity. However, this protein does stimulate de novo methylation by DNA cytosine methyltransferase 3 alpha and it is thought to be required for the establishment of maternal genomic imprints. This protein also mediates transcriptional repression through interaction with histone deacetylase 1. Alternative splicing results in two transcript variants. An additional splice variant has been described but its biological validity has not been determined.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed at low levels in several tissues including testis, ovary, and thymus.
Biological activity : This product is useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced.
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSSRHWALVSEEELSLLAQNKQSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL
Sequence Similarities : Belongs to the C5-methyltransferase family.Contains 1 ADD-type zinc finger.
Gene Name DNMT3L DNA (cytosine-5-)-methyltransferase 3-like [ Homo sapiens ]
Official Symbol DNMT3L
Synonyms DNMT3L; DNA (cytosine-5-)-methyltransferase 3-like; DNA (cytosine-5)-methyltransferase 3-like; cytosine 5 methyltransferase 3 like protein; human cytosine 5 methyltransferase 3 like protein; MGC1090;
Gene ID 29947
mRNA Refseq NM_013369
Protein Refseq NP_037501
MIM 606588
Uniprot ID Q9UJW3
Chromosome Location 21q22.3
Pathway Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Methionine degradation, organism-specific biosystem; Methionine degradation, conserved biosystem;
Function enzyme activator activity; enzyme binding; metal ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNMT3L Products

Required fields are marked with *

My Review for All DNMT3L Products

Required fields are marked with *

0
cart-icon
0
compare icon