Recombinant Human DNMT3L
Cat.No. : | DNMT3L-26950TH |
Product Overview : | Recombinant fragment corresponding to aa 288-387 of human Dnmt3L with a proprietary tag; 36.63kDa inclusive of tag; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a nuclear protein with similarity to DNA methyltransferases. This protein is not thought to function as a DNA methyltransferase as it does not contain the amino acid residues necessary for methyltransferase activity. However, this protein does stimulate de novo methylation by DNA cytosine methyltransferase 3 alpha and it is thought to be required for the establishment of maternal genomic imprints. This protein also mediates transcriptional repression through interaction with histone deacetylase 1. Alternative splicing results in two transcript variants. An additional splice variant has been described but its biological validity has not been determined. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed at low levels in several tissues including testis, ovary, and thymus. |
Biological activity : | This product is useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced. |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSSRHWALVSEEELSLLAQNKQSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL |
Sequence Similarities : | Belongs to the C5-methyltransferase family.Contains 1 ADD-type zinc finger. |
Gene Name | DNMT3L DNA (cytosine-5-)-methyltransferase 3-like [ Homo sapiens ] |
Official Symbol | DNMT3L |
Synonyms | DNMT3L; DNA (cytosine-5-)-methyltransferase 3-like; DNA (cytosine-5)-methyltransferase 3-like; cytosine 5 methyltransferase 3 like protein; human cytosine 5 methyltransferase 3 like protein; MGC1090; |
Gene ID | 29947 |
mRNA Refseq | NM_013369 |
Protein Refseq | NP_037501 |
MIM | 606588 |
Uniprot ID | Q9UJW3 |
Chromosome Location | 21q22.3 |
Pathway | Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Methionine degradation, organism-specific biosystem; Methionine degradation, conserved biosystem; |
Function | enzyme activator activity; enzyme binding; metal ion binding; protein binding; |
◆ Recombinant Proteins | ||
DNMT3L-26950TH | Recombinant Human DNMT3L | +Inquiry |
DNMT3L-931H | Active Recombinant Full Length Human DNMT3L Protein, N-6xHis-tagged | +Inquiry |
Dnmt3l-2623M | Recombinant Mouse Dnmt3l Protein, Myc/DDK-tagged | +Inquiry |
DNMT3L-1586R | Recombinant Rat DNMT3L Protein, His (Fc)-Avi-tagged | +Inquiry |
DNMT3L-6951H | Recombinant Human DNMT3L, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNMT3L-6853HCL | Recombinant Human DNMT3L 293 Cell Lysate | +Inquiry |
DNMT3L-6852HCL | Recombinant Human DNMT3L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNMT3L Products
Required fields are marked with *
My Review for All DNMT3L Products
Required fields are marked with *