Recombinant Human DOCK4 protein, His-tagged
Cat.No. : | DOCK4-3468H |
Product Overview : | Recombinant Human DOCK4 protein(1838-1971 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1838-1971 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RPTQTASPARHTTSVSPSPAGRSPLKGSVQSFTPSPVEYHSPGLISNSPVLSGSYSSGISSLSRCSTSETSGFENQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPIPLPHSLSIPVTS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DOCK4 dedicator of cytokinesis 4 [ Homo sapiens ] |
Official Symbol | DOCK4 |
Synonyms | DOCK4; dedicator of cytokinesis 4; dedicator of cytokinesis protein 4; FLJ34238; KIAA0716; MGC134911; MGC134912; |
Gene ID | 9732 |
mRNA Refseq | NM_014705 |
Protein Refseq | NP_055520 |
MIM | 607679 |
UniProt ID | Q8N1I0 |
◆ Recombinant Proteins | ||
DOCK4-2283H | Recombinant Human DOCK4 Protein (Met1-Pro300), N-His tagged | +Inquiry |
DOCK4-4754M | Recombinant Mouse DOCK4 Protein | +Inquiry |
DOCK4-403H | Recombinant Human DOCK4 Protein, His/GST-tagged | +Inquiry |
DOCK4-2806H | Recombinant Human DOCK4 Protein, GST-tagged | +Inquiry |
DOCK4-3468H | Recombinant Human DOCK4 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DOCK4 Products
Required fields are marked with *
My Review for All DOCK4 Products
Required fields are marked with *
0
Inquiry Basket