Recombinant Human DOK2, His-tagged
Cat.No. : | DOK2-28083TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 21-133 of Human DOK2 with a N terminal His tag; Predicted MWt 13 kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-133 a.a. |
Description : | The protein encoded by this gene is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210(bcr/abl), a chimeric protein whose presence is associated with CML. This encoded protein binds p120 (RasGAP) from CML cells. |
Conjugation : | HIS |
Tissue specificity : | Highly expressed in peripheral blood leukocytes, lymph nodes and spleen. Lower expression in thymus, bone marrow and fetal liver. |
Form : | Lyophilised:Reconstitution with 76 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVI RLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAP AAERGDWVQAICLLAFPGQRKELSGPEGKQSRPCM |
Sequence Similarities : | Belongs to the DOK family. Type A subfamily.Contains 1 IRS-type PTB domain.Contains 1 PH domain. |
Gene Name | DOK2 docking protein 2, 56kDa [ Homo sapiens ] |
Official Symbol | DOK2 |
Synonyms | DOK2; docking protein 2, 56kDa; docking protein 2, 56kD; docking protein 2; Dok 2; p56dok 2; |
Gene ID | 9046 |
mRNA Refseq | NM_003974 |
Protein Refseq | NP_003965 |
MIM | 604997 |
Uniprot ID | O60496 |
Chromosome Location | 8p21.3 |
Pathway | Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Hemostasis, organism-specific biosystem; IL-4 signaling Pathway, organism-specific biosystem; |
Function | insulin receptor binding; receptor signaling protein activity; transmembrane receptor protein tyrosine kinase adaptor activity; |
◆ Recombinant Proteins | ||
Dok2-2630M | Recombinant Mouse Dok2 Protein, Myc/DDK-tagged | +Inquiry |
DOK2-4761M | Recombinant Mouse DOK2 Protein | +Inquiry |
DOK2-2483M | Recombinant Mouse DOK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DOK2-1233H | Recombinant Human DOK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DOK2-2810H | Recombinant Human DOK2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DOK2-6847HCL | Recombinant Human DOK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DOK2 Products
Required fields are marked with *
My Review for All DOK2 Products
Required fields are marked with *