Recombinant Human DPCD protein, His-tagged
| Cat.No. : | DPCD-477H |
| Product Overview : | Recombinant Human DPCD protein(1-203 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-203 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKFSIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCKTQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | DPCD deleted in primary ciliary dyskinesia homolog (mouse) [ Homo sapiens ] |
| Official Symbol | DPCD |
| Synonyms | DPCD; deleted in primary ciliary dyskinesia homolog (mouse); protein DPCD; DKFZP566F084; RP11 529I10.4; deleted in a mouse model of primary ciliary dyskinesia; RP11-529I10.4; DKFZp566F084; |
| Gene ID | 25911 |
| mRNA Refseq | NM_015448 |
| Protein Refseq | NP_056263 |
| UniProt ID | Q9BVM2 |
| ◆ Recombinant Proteins | ||
| DPCD-2361H | Recombinant Human DPCD protein, GST-tagged | +Inquiry |
| DPCD-1934R | Recombinant Rat DPCD Protein | +Inquiry |
| DPCD-477H | Recombinant Human DPCD protein, His-tagged | +Inquiry |
| DPCD-4350Z | Recombinant Zebrafish DPCD | +Inquiry |
| DPCD-2493M | Recombinant Mouse DPCD Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DPCD-6839HCL | Recombinant Human DPCD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPCD Products
Required fields are marked with *
My Review for All DPCD Products
Required fields are marked with *
