Recombinant Human DPCD protein, His-tagged
Cat.No. : | DPCD-477H |
Product Overview : | Recombinant Human DPCD protein(NP_056263)(1-203 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-203 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKFSIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCKTQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DPCD deleted in primary ciliary dyskinesia homolog (mouse) [ Homo sapiens ] |
Official Symbol | DPCD |
Synonyms | DPCD; deleted in primary ciliary dyskinesia homolog (mouse); protein DPCD; DKFZP566F084; RP11 529I10.4; deleted in a mouse model of primary ciliary dyskinesia; RP11-529I10.4; DKFZp566F084; |
Gene ID | 25911 |
mRNA Refseq | NM_015448 |
Protein Refseq | NP_056263 |
UniProt ID | Q9BVM2 |
◆ Recombinant Proteins | ||
DPCD-2361H | Recombinant Human DPCD, GST-tagged | +Inquiry |
DPCD-4782C | Recombinant Chicken DPCD | +Inquiry |
DPCD-4781C | Recombinant Chicken DPCD | +Inquiry |
DPCD-3006H | Recombinant Human DPCD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DPCD-4777M | Recombinant Mouse DPCD Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPCD-6839HCL | Recombinant Human DPCD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPCD Products
Required fields are marked with *
My Review for All DPCD Products
Required fields are marked with *