Recombinant Human DPT protein, Fc-His-tagged
Cat.No. : | DPT-199H |
Product Overview : | Recombinant Human DPT protein(Q07507)(Gln19-Val201), fused with C-terminal Fc tag and His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Gln19-Val201 |
Form : | 20mM PB, 4% Sucrose, 4% mannitol, 0.02% Tween80, pH 7.5 |
Storage : | The lyophilized protein should be stored at ≤ -20°C and remains stable for up to one year from the date of receipt. Upon reconstitution, the protein solution can be stored at 2-8°C for 2-7 days. For longer-term storage, aliquots of the reconstituted protein are stable at ≤ -20°C for up to 3 months. |
Molecular Mass : | 49.9 KDa |
AA Sequence : | QYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Endotoxin : | < 1 EU/µg as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Official Symbol | DPT |
Synonyms | DPT; dermatopontin; tyrosine-rich acidic matrix protein; TRAMP; |
Gene ID | 1805 |
mRNA Refseq | NM_001937 |
Protein Refseq | NP_001928 |
MIM | 125597 |
UniProt ID | Q07507 |
◆ Recombinant Proteins | ||
DPT-673H | Recombinant Human DPT Protein, His-tagged | +Inquiry |
Dpt-419M | Active Recombinant Mouse Dermatopontin, His-tagged | +Inquiry |
DPT-2855H | Recombinant Human DPT Protein, GST-tagged | +Inquiry |
DPT-4156HF | Recombinant Full Length Human DPT Protein, GST-tagged | +Inquiry |
DPT-1984H | Recombinant Human DPT Protein (Gln19-Val201), C-His and Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPT-6823HCL | Recombinant Human DPT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPT Products
Required fields are marked with *
My Review for All DPT Products
Required fields are marked with *