Recombinant Human DPT protein, Fc-His-tagged

• Cat.No.: DPT-199H
• Product Overview: Recombinant Human DPT protein(Q07507)(Gln19-Val201), fused with C-terminal Fc tag and His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: Gln19-Val201
• Form: 20mM PB, 4% Sucrose, 4% mannitol, 0.02% Tween80, pH 7.5
• Storage: The lyophilized protein should be stored at ≤ -20°C and remains stable for up to one year from the date of receipt. Upon reconstitution, the protein solution can be stored at 2-8°C for 2-7 days. For longer-term storage, aliquots of the reconstituted protein are stable at ≤ -20°C for up to 3 months.
• Molecular Mass: 49.9 KDa
• AA Sequence: QYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANVVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
• Endotoxin: < 1 EU/µg as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.

Gene Information

• Official Symbol: DPT
• Synonyms: DPT; dermatopontin; tyrosine-rich acidic matrix protein; TRAMP
• Gene ID: 1805
• mRNA Refseq: NM_001937
• Protein Refseq: NP_001928
• MIM: 125597
• UniProt ID: Q07507