Recombinant Human DPT protein, T7/His-tagged

Cat.No. : DPT-66H
Product Overview : Recombinant human Dermatopontin (DPT) gene cDNA (19 - 201aa, derived from BC033736) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 19-201 a.a.
Form : 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIF SKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKR CPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro DPT mediated TGFb activity for various cell differentiation regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for DPT protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. Potential biomarker protein for cancer diagnosis, such as for human oral cancer.5. May be used for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name DPT dermatopontin [ Homo sapiens ]
Official Symbol DPT
Synonyms DPT; dermatopontin; tyrosine-rich acidic matrix protein; TRAMP;
Gene ID 1805
mRNA Refseq NM_001937
Protein Refseq NP_001928
MIM 125597
UniProt ID Q07507
Chromosome Location 1q12-q23

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DPT Products

Required fields are marked with *

My Review for All DPT Products

Required fields are marked with *

0
cart-icon
0
compare icon