Recombinant Human DPYD
| Cat.No. : | DPYD-28435TH |
| Product Overview : | Recombinant Human DPYD (1a.a. - 173 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | The protein encoded by this gene is a pyrimidine catabolic enzyme and the initial and rate-limiting factor in the pathway of uracil and thymidine catabolism. Mutations in this gene result in dihydropyrimidine dehydrogenase deficiency, an error in pyrimidine metabolism associated with thymine-uraciluria and an increased risk of toxicity in cancer patients receiving 5-fluorouracil chemotherapy. Two transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | 44.66 kDa |
| AA Sequence : | MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCFNCEKLENNFDDIKHTTLGERGALRE AMRCLKCADAPCQKSCPTNLDIKSFITSIANKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGCNLYATEEGPI NIGGLQQFATETLILAFSLMNHL |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DPYD dihydropyrimidine dehydrogenase [ Homo sapiens (human) ] |
| Official Symbol | DPYD |
| Synonyms | DPYD; DHP; DPD; DHPDHASE; dihydropyrimidine dehydrogenase; dihydropyrimidine dehydrogenase [NADP(+)]; dihydrouracil dehydrogenase; dihydrothymine dehydrogenase; NP_000101.2; EC 1.3.1.2; NP_001153773.1 |
| Gene ID | 1806 |
| mRNA Refseq | NM_000110 |
| Protein Refseq | NP_000101 |
| MIM | 612779 |
| UniProt ID | Q12882 |
| Chromosome Location | 1p22 |
| Pathway | Drug metabolism - other enzymes; Pantothenate and CoA biosynthesis; beta-Alanine metabolism |
| Function | 4 iron, 4 sulfur cluster binding; dihydroorotate oxidase activity; dihydropyrimidine dehydrogenase (NADP+) activity |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPYD Products
Required fields are marked with *
My Review for All DPYD Products
Required fields are marked with *



