Recombinant Human DPYSL2, GST-tagged

• Cat.No.: DPYSL2-102H
• Product Overview: Recombinant Human DPYSL2(470 a.a. - 571 a.a.), fused with GST-tag at N-terminal, was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Molecular Mass: 36.96 kDa
• AA Sequence: PRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGA QIDDNIPRRTTQRIVAPPGGRANITSL
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DPYSL2?dihydropyrimidinase-like 2 [?Homo sapiens?(human) ]
• Official Symbol: DPYSL2
• Synonyms: DPYSL2; DRP2; N2A3; CRMP2; DRP-2; ULIP2; CRMP-2; DHPRP2; ULIP-2; dihydropyrimidinase-like 2; dihydropyrimidinase-related protein 2; unc-33-like phosphoprotein 2; collapsin response mediator protein hCRMP-2
• Gene ID: 1808
• mRNA Refseq: NM_001386
• Protein Refseq: NP_001377
• MIM: 602463
• UniProt ID: Q16555
• Chromosome Location: 8p22-p21
• Pathway: BDNF signaling pathway; CRMPs in Sema3A signaling; Regulation of Microtubule Cytoskeleton
• Function: dihydropyrimidinase activity; protein binding; protein kinase binding