Recombinant Human DPYSL2, GST-tagged
| Cat.No. : | DPYSL2-102H |
| Product Overview : | Recombinant Human DPYSL2(470 a.a. - 571 a.a.), fused with GST-tag at N-terminal, was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Molecular Mass : | 36.96 kDa |
| AA Sequence : | PRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGA QIDDNIPRRTTQRIVAPPGGRANITSL |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DPYSL2?dihydropyrimidinase-like 2 [?Homo sapiens?(human) ] |
| Official Symbol | DPYSL2 |
| Synonyms | DPYSL2; DRP2; N2A3; CRMP2; DRP-2; ULIP2; CRMP-2; DHPRP2; ULIP-2; dihydropyrimidinase-like 2; dihydropyrimidinase-related protein 2; unc-33-like phosphoprotein 2; collapsin response mediator protein hCRMP-2 |
| Gene ID | 1808 |
| mRNA Refseq | NM_001386 |
| Protein Refseq | NP_001377 |
| MIM | 602463 |
| UniProt ID | Q16555 |
| Chromosome Location | 8p22-p21 |
| Pathway | BDNF signaling pathway; CRMPs in Sema3A signaling; Regulation of Microtubule Cytoskeleton |
| Function | dihydropyrimidinase activity; protein binding; protein kinase binding |
| ◆ Recombinant Proteins | ||
| DPYSL2-4812M | Recombinant Mouse DPYSL2 Protein | +Inquiry |
| DPYSL2-101H | Recombinant Human DPYSL2, GST-tagged | +Inquiry |
| DPYSL2-2539H | Recombinant Human DPYSL2 Protein, MYC/DDK-tagged | +Inquiry |
| DPYSL2-1608R | Recombinant Rat DPYSL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DPYSL2-1193H | Recombinant Full Length Human DPYSL2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPYSL2 Products
Required fields are marked with *
My Review for All DPYSL2 Products
Required fields are marked with *



