Recombinant Full Length Human DPYSL2 Protein
| Cat.No. : | DPYSL2-1193H |
| Product Overview : | Recombinant Human DPYSL3 Protein (1-572aa) was expressed in Yeast with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-572 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 64.3 kDa |
| AA Sequence : | MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | DPYSL2 dihydropyrimidinase-like 2 [ Homo sapiens (human) ] |
| Official Symbol | DPYSL2 |
| Synonyms | DPYSL2; DRP2; N2A3; CRMP2; DRP-2; ULIP2; CRMP-2; DHPRP2; ULIP-2; dihydropyrimidinase-like 2; dihydropyrimidinase-related protein 2; unc-33-like phosphoprotein 2; collapsin response mediator protein hCRMP-2 |
| Gene ID | 1808 |
| mRNA Refseq | NM_001386 |
| Protein Refseq | NP_001377 |
| MIM | 602463 |
| UniProt ID | Q16555 |
| ◆ Recombinant Proteins | ||
| DPYSL2-3908H | Recombinant Human DPYSL2 protein, His-tagged | +Inquiry |
| DPYSL2-6183H | Recombinant Human DPYSL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Dpysl2-2651M | Recombinant Mouse Dpysl2 Protein, Myc/DDK-tagged | +Inquiry |
| DPYSL2-1988H | Recombinant Human DPYSL2 Protein (Thr13-Glu490), N-His tagged | +Inquiry |
| DPYSL2-6064C | Recombinant Chicken DPYSL2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPYSL2 Products
Required fields are marked with *
My Review for All DPYSL2 Products
Required fields are marked with *
