Recombinant Human DPYSL2 protein, His-tagged

Cat.No. : DPYSL2-3908H
Product Overview : Recombinant Human DPYSL2 protein(224-572 aa), fused to His tag, was expressed in E. coli.
Availability July 22, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 224-572 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : VLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name DPYSL2 dihydropyrimidinase-like 2 [ Homo sapiens ]
Official Symbol DPYSL2
Synonyms DPYSL2; dihydropyrimidinase-like 2; dihydropyrimidinase-related protein 2; CRMP2; DHPRP2; DRP 2; DRP2; unc-33-like phosphoprotein 2; collapsin response mediator protein hCRMP-2; N2A3; DRP-2; ULIP2; CRMP-2; ULIP-2;
Gene ID 1808
mRNA Refseq NM_001197293
Protein Refseq NP_001184222
MIM 602463
UniProt ID Q16555

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DPYSL2 Products

Required fields are marked with *

My Review for All DPYSL2 Products

Required fields are marked with *

0
cart-icon