Recombinant Human DPYSL2 protein, His-tagged

• Cat.No.: DPYSL2-3908H
• Product Overview: Recombinant Human DPYSL2 protein(224-572 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 224-572 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: VLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DPYSL2 dihydropyrimidinase-like 2 [ Homo sapiens ]
• Official Symbol: DPYSL2
• Synonyms: DPYSL2; dihydropyrimidinase-like 2; dihydropyrimidinase-related protein 2; CRMP2; DHPRP2; DRP 2; DRP2; unc-33-like phosphoprotein 2; collapsin response mediator protein hCRMP-2; N2A3; DRP-2; ULIP2; CRMP-2; ULIP-2
• Gene ID: 1808
• mRNA Refseq: NM_001197293
• Protein Refseq: NP_001184222
• MIM: 602463
• UniProt ID: Q16555