Recombinant Human DPYSL2 protein, His-tagged
Cat.No. : | DPYSL2-3908H |
Product Overview : | Recombinant Human DPYSL2 protein(224-572 aa), fused to His tag, was expressed in E. coli. |
Availability | July 22, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 224-572 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DPYSL2 dihydropyrimidinase-like 2 [ Homo sapiens ] |
Official Symbol | DPYSL2 |
Synonyms | DPYSL2; dihydropyrimidinase-like 2; dihydropyrimidinase-related protein 2; CRMP2; DHPRP2; DRP 2; DRP2; unc-33-like phosphoprotein 2; collapsin response mediator protein hCRMP-2; N2A3; DRP-2; ULIP2; CRMP-2; ULIP-2; |
Gene ID | 1808 |
mRNA Refseq | NM_001197293 |
Protein Refseq | NP_001184222 |
MIM | 602463 |
UniProt ID | Q16555 |
◆ Recombinant Proteins | ||
DPYSL2-42HFL | Active Recombinant Full Length Human DPYSL2 Protein, C-Flag-tagged | +Inquiry |
DPYSL2-4812M | Recombinant Mouse DPYSL2 Protein | +Inquiry |
DPYSL2-6907HF | Recombinant Full Length Human DPYSL2 Protein, GST-tagged | +Inquiry |
DPYSL2-1988H | Recombinant Human DPYSL2 Protein (Thr13-Glu490), N-His tagged | +Inquiry |
Dpysl2-2651M | Recombinant Mouse Dpysl2 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPYSL2 Products
Required fields are marked with *
My Review for All DPYSL2 Products
Required fields are marked with *