Recombinant Human DRAP1 Protein (4-198 aa), GST-tagged

Cat.No. : DRAP1-1212H
Product Overview : Recombinant Human DRAP1 Protein (4-198 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transcription. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 4-198 aa
Description : The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 48.2 kDa
AA Sequence : KKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEE
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name DRAP1 DR1-associated protein 1 (negative cofactor 2 alpha) [ Homo sapiens ]
Official Symbol DRAP1
Synonyms DRAP1; NC2 alpha; NC2-alpha;
Gene ID 10589
mRNA Refseq NM_006442
Protein Refseq NP_006433
MIM 602289
UniProt ID Q14919

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DRAP1 Products

Required fields are marked with *

My Review for All DRAP1 Products

Required fields are marked with *

0
cart-icon