Recombinant Human DRAP1 Protein (4-198 aa), GST-tagged
| Cat.No. : | DRAP1-1212H |
| Product Overview : | Recombinant Human DRAP1 Protein (4-198 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transcription. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 4-198 aa |
| Description : | The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 48.2 kDa |
| AA Sequence : | KKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | DRAP1 DR1-associated protein 1 (negative cofactor 2 alpha) [ Homo sapiens ] |
| Official Symbol | DRAP1 |
| Synonyms | DRAP1; NC2 alpha; NC2-alpha; |
| Gene ID | 10589 |
| mRNA Refseq | NM_006442 |
| Protein Refseq | NP_006433 |
| MIM | 602289 |
| UniProt ID | Q14919 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DRAP1 Products
Required fields are marked with *
My Review for All DRAP1 Products
Required fields are marked with *



