Recombinant Human DRAP1 Protein (4-198 aa), GST-tagged

• Cat.No.: DRAP1-1212H
• Product Overview: Recombinant Human DRAP1 Protein (4-198 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transcription. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 4-198 aa
• Description: The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 48.2 kDa
• AA Sequence: KKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: DRAP1 DR1-associated protein 1 (negative cofactor 2 alpha) [ Homo sapiens ]
• Official Symbol: DRAP1
• Synonyms: DRAP1; NC2 alpha; NC2-alpha
• Gene ID: 10589
• mRNA Refseq: NM_006442
• Protein Refseq: NP_006433
• MIM: 602289
• UniProt ID: Q14919