Recombinant Human DRAP1 Protein (4-198 aa), GST-tagged
Cat.No. : | DRAP1-1212H |
Product Overview : | Recombinant Human DRAP1 Protein (4-198 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Transcription. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 4-198 aa |
Description : | The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 48.2 kDa |
AA Sequence : | KKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | DRAP1 DR1-associated protein 1 (negative cofactor 2 alpha) [ Homo sapiens ] |
Official Symbol | DRAP1 |
Synonyms | DRAP1; NC2 alpha; NC2-alpha; |
Gene ID | 10589 |
mRNA Refseq | NM_006442 |
Protein Refseq | NP_006433 |
MIM | 602289 |
UniProt ID | Q14919 |
◆ Recombinant Proteins | ||
DRAP1-1153R | Recombinant Rhesus Macaque DRAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DRAP1-2670H | Recombinant Human DRAP1, His-tagged | +Inquiry |
DRAP1-2873H | Recombinant Human DRAP1 Protein, GST-tagged | +Inquiry |
Drap1-2657M | Recombinant Mouse Drap1 Protein, Myc/DDK-tagged | +Inquiry |
DRAP1-4181HF | Recombinant Full Length Human DRAP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DRAP1-6819HCL | Recombinant Human DRAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DRAP1 Products
Required fields are marked with *
My Review for All DRAP1 Products
Required fields are marked with *