Recombinant Human DSC2 protein(771-890 aa), C-His-tagged
| Cat.No. : | DSC2-2821H |
| Product Overview : | Recombinant Human DSC2 protein(Q02487)(771-890 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 771-890 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | TVGSGIKNGGQETIEMVKGGHQTSESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKVYLCNQDENHKHAQDYVLTYNYEGRGSVAGSVGCCSERQEEDGLEFLDNLEPK |
| Gene Name | DSC2 desmocollin 2 [ Homo sapiens ] |
| Official Symbol | DSC2 |
| Synonyms | DSC2; desmocollin 2; DSC3; desmocollin-2; CDHF2; cadherin family member 2; desmosomal glycoprotein II; desmosomal glycoprotein III; desmosomal glycoprotein II/III; DG2; ARVD11; DGII/III; DKFZp686I11137; |
| Gene ID | 1824 |
| mRNA Refseq | NM_004949 |
| Protein Refseq | NP_004940 |
| MIM | 125645 |
| UniProt ID | Q02487 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSC2 Products
Required fields are marked with *
My Review for All DSC2 Products
Required fields are marked with *



