Recombinant Human DSC2 protein(771-890 aa), C-His-tagged
Cat.No. : | DSC2-2821H |
Product Overview : | Recombinant Human DSC2 protein(Q02487)(771-890 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 771-890 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | TVGSGIKNGGQETIEMVKGGHQTSESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKVYLCNQDENHKHAQDYVLTYNYEGRGSVAGSVGCCSERQEEDGLEFLDNLEPK |
Gene Name | DSC2 desmocollin 2 [ Homo sapiens ] |
Official Symbol | DSC2 |
Synonyms | DSC2; desmocollin 2; DSC3; desmocollin-2; CDHF2; cadherin family member 2; desmosomal glycoprotein II; desmosomal glycoprotein III; desmosomal glycoprotein II/III; DG2; ARVD11; DGII/III; DKFZp686I11137; |
Gene ID | 1824 |
mRNA Refseq | NM_004949 |
Protein Refseq | NP_004940 |
MIM | 125645 |
UniProt ID | Q02487 |
◆ Recombinant Proteins | ||
DSC2-4443H | Recombinant Human DSC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Dsc2-2662M | Recombinant Mouse Dsc2 Protein, Myc/DDK-tagged | +Inquiry |
DSC2-4832M | Recombinant Mouse DSC2 Protein | +Inquiry |
DSC2-2534M | Recombinant Mouse DSC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DSC2-2527H | Recombinant Human DSC2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DSC2-2051HCL | Recombinant Human DSC2 cell lysate | +Inquiry |
DSC2-1159RCL | Recombinant Rat DSC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DSC2 Products
Required fields are marked with *
My Review for All DSC2 Products
Required fields are marked with *
0
Inquiry Basket