Recombinant Human DSC2 protein(771-890 aa), C-His-tagged

Cat.No. : DSC2-2821H
Product Overview : Recombinant Human DSC2 protein(Q02487)(771-890 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 771-890 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : TVGSGIKNGGQETIEMVKGGHQTSESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKVYLCNQDENHKHAQDYVLTYNYEGRGSVAGSVGCCSERQEEDGLEFLDNLEPK
Gene Name DSC2 desmocollin 2 [ Homo sapiens ]
Official Symbol DSC2
Synonyms DSC2; desmocollin 2; DSC3; desmocollin-2; CDHF2; cadherin family member 2; desmosomal glycoprotein II; desmosomal glycoprotein III; desmosomal glycoprotein II/III; DG2; ARVD11; DGII/III; DKFZp686I11137;
Gene ID 1824
mRNA Refseq NM_004949
Protein Refseq NP_004940
MIM 125645
UniProt ID Q02487

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DSC2 Products

Required fields are marked with *

My Review for All DSC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon