Recombinant Human DSCAM Protein, GST-tagged

Cat.No. : DSCAM-2882H
Product Overview : Human DSCAM partial ORF ( NP_001380, 184 a.a. - 271 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the immunoglobulin superfamily of cell adhesion molecules (Ig-CAMs), and is involved in human central and peripheral nervous system development. This gene is a candidate for Down syndrome and congenital heart disease (DSCHD). A gene encoding a similar Ig-CAM protein is located on chromosome 11. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2012]
Molecular Mass : 35.42 kDa
AA Sequence : KDVQNEDGLYNYRCITRHRYTGETRQSNSARLFVSDPANSAPSILDGFDHRKAMAGQRVELPCKALGHPEPDYRWLKDNMPLELSGRF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DSCAM Down syndrome cell adhesion molecule [ Homo sapiens ]
Official Symbol DSCAM
Synonyms DSCAM; Down syndrome cell adhesion molecule; CHD2 42; CHD2 52; CHD2; human CHD2-52 down syndrome cell adhesion molecule; CHD2-42; CHD2-52;
Gene ID 1826
mRNA Refseq NM_001389
Protein Refseq NP_001380
MIM 602523
UniProt ID O60469

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DSCAM Products

Required fields are marked with *

My Review for All DSCAM Products

Required fields are marked with *

0
cart-icon