Recombinant Human DTX2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DTX2-1319H |
| Product Overview : | DTX2 MS Standard C13 and N15-labeled recombinant protein (NP_065943) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | DTX2 functions as an E3 ubiquitin ligase. |
| Molecular Mass : | 67.2 kDa |
| AA Sequence : | MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLAHSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGSWTAYEASVCDYLEQQVARGNQLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPYPVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLYRSSLSHLGPQHLPPGSSTSGAVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPTSPPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLSAASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPQGKMEVLRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPNYLQNVLAELAAQGVTEDCLEQQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | DTX2 deltex E3 ubiquitin ligase 2 [ Homo sapiens (human) ] |
| Official Symbol | DTX2 |
| Synonyms | DTX2; deltex homolog 2 (Drosophila); deltex (Drosophila) homolog 2; protein deltex-2; RNF58; hDTX2; deltex2; ring finger protein 58; zinc ion binding protein; KIAA1528; MGC71098; |
| Gene ID | 113878 |
| mRNA Refseq | NM_020892 |
| Protein Refseq | NP_065943 |
| MIM | 613141 |
| UniProt ID | Q86UW9 |
| ◆ Recombinant Proteins | ||
| DTX2-4857M | Recombinant Mouse DTX2 Protein | +Inquiry |
| DTX2-6535H | Recombinant Human DTX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DTX2-12191H | Recombinant Human DTX2, GST-tagged | +Inquiry |
| DTX2-6778Z | Recombinant Zebrafish DTX2 | +Inquiry |
| DTX2-2714H | Recombinant Human DTX2 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DTX2-513HCL | Recombinant Human DTX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DTX2 Products
Required fields are marked with *
My Review for All DTX2 Products
Required fields are marked with *



