Recombinant Human DUSP2, GST-tagged

Cat.No. : DUSP2-101H
Product Overview : Human DUSP2 full-length ORF ( ACE87730.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1 and ERK2, is predominantly expressed in hematopoietic tissues, and is localized in the nucleus.
Molecular Mass : 60.94 kDa
AA Sequence : MGLEAARELECAALGTLLRDPREAERTLLLDCRPFLAFCRRHVRAARPVPWNALLRRRARGPPAAVLACLLPDRA LRTRLVRGELARAVVLDEGSASVAELRPDSPAHVLLAALLHETRAGPTAVYFLRGGFDGFQGCCPDLCSEAPAPA LPPTGDKTSRSDSRAPVYDQGGPVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSASCPNHFEGLFRYKSIPVE DNQMVEISAWFQEAIGFIDWVKNSGGRVLVHCQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSF MGQLLQFETQVLCH
Applications : ELISA; WB; Antibody Production; Protein Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DUSP2 dual specificity phosphatase 2 [ Homo sapiens (human) ]
Official Symbol DUSP2
Synonyms DUSP2; PAC1; PAC-1; dual specificity phosphatase 2; dual-specificity phosphatase 2; dual specificity protein phosphatase PAC-1; serine/threonine specific protein phosphatase; EC 3.1.3.16; EC 3.1.3.48
Gene ID 1844
mRNA Refseq NM_004418
Protein Refseq NP_004409
MIM 603068
UniProt ID Q05923
Chromosome Location 2q11
Pathway MAPK signaling pathway
Function MAP kinase tyrosine/serine/threonine phosphatase activity; mitogen-activated protein kinase binding; protein tyrosine phosphatase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUSP2 Products

Required fields are marked with *

My Review for All DUSP2 Products

Required fields are marked with *

0
cart-icon