Recombinant Human DUSP2, GST-tagged
Cat.No. : | DUSP2-101H |
Product Overview : | Human DUSP2 full-length ORF ( ACE87730.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1 and ERK2, is predominantly expressed in hematopoietic tissues, and is localized in the nucleus. |
Molecular Mass : | 60.94 kDa |
AA Sequence : | MGLEAARELECAALGTLLRDPREAERTLLLDCRPFLAFCRRHVRAARPVPWNALLRRRARGPPAAVLACLLPDRA LRTRLVRGELARAVVLDEGSASVAELRPDSPAHVLLAALLHETRAGPTAVYFLRGGFDGFQGCCPDLCSEAPAPA LPPTGDKTSRSDSRAPVYDQGGPVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSASCPNHFEGLFRYKSIPVE DNQMVEISAWFQEAIGFIDWVKNSGGRVLVHCQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSF MGQLLQFETQVLCH |
Applications : | ELISA; WB; Antibody Production; Protein Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DUSP2 dual specificity phosphatase 2 [ Homo sapiens (human) ] |
Official Symbol | DUSP2 |
Synonyms | DUSP2; PAC1; PAC-1; dual specificity phosphatase 2; dual-specificity phosphatase 2; dual specificity protein phosphatase PAC-1; serine/threonine specific protein phosphatase; EC 3.1.3.16; EC 3.1.3.48 |
Gene ID | 1844 |
mRNA Refseq | NM_004418 |
Protein Refseq | NP_004409 |
MIM | 603068 |
UniProt ID | Q05923 |
Chromosome Location | 2q11 |
Pathway | MAPK signaling pathway |
Function | MAP kinase tyrosine/serine/threonine phosphatase activity; mitogen-activated protein kinase binding; protein tyrosine phosphatase activity |
◆ Recombinant Proteins | ||
DUSP2-2566M | Recombinant Mouse DUSP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP2-4883M | Recombinant Mouse DUSP2 Protein | +Inquiry |
DUSP2-898Z | Recombinant Zebrafish DUSP2 | +Inquiry |
DUSP2-132HF | Recombinant Full Length Human DUSP2 Protein, GST-tagged | +Inquiry |
DUSP2-45H | Recombinant Human DUSP2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUSP2 Products
Required fields are marked with *
My Review for All DUSP2 Products
Required fields are marked with *
0
Inquiry Basket