Recombinant Human DUSP26, His-tagged
| Cat.No. : | DUSP26-26910TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 29-211 of Human DUSP26 with N terminal His tag; 183 amino acids, 21kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 29-211 a.a. |
| Conjugation : | HIS |
| Tissue specificity : | Brain. In the brain it is expressed ubiquitously except in the hippocampus. Expressed in embryonal cancers (retinoblastoma, neuroepithilioma and neuroblastoma) and in anaplatic thyroid cancer. |
| Form : | Lyophilised:Reconstitute with 144 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | RGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPG LYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAY EGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQP GGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKD HRGIIPNRGFLRQLLALDRRLRQGLEA |
| Sequence Similarities : | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 tyrosine-protein phosphatase domain. |
| Gene Name | DUSP26 dual specificity phosphatase 26 (putative) [ Homo sapiens ] |
| Official Symbol | DUSP26 |
| Synonyms | DUSP26; dual specificity phosphatase 26 (putative); dual specificity protein phosphatase 26; DUSP24; MGC1136; |
| Gene ID | 78986 |
| mRNA Refseq | NM_024025 |
| Protein Refseq | NP_076930 |
| Uniprot ID | Q9BV47 |
| Chromosome Location | 8p12 |
| Function | hydrolase activity; protein binding; protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity; |
| ◆ Recombinant Proteins | ||
| DUSP26-2569M | Recombinant Mouse DUSP26 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DUSP26-2937H | Recombinant Human DUSP26 Protein, GST-tagged | +Inquiry |
| DUSP26-2324H | Recombinant Human DUSP26 protein, His-tagged | +Inquiry |
| DUSP26-4788H | Recombinant Human DUSP26 protein, His-SUMO-tagged | +Inquiry |
| DUSP26-1634R | Recombinant Rat DUSP26 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DUSP26-6775HCL | Recombinant Human DUSP26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP26 Products
Required fields are marked with *
My Review for All DUSP26 Products
Required fields are marked with *
