Recombinant Human DVL3
| Cat.No. : | DVL3-28354TH |
| Product Overview : | Recombinant fragment of Human Dishevelled 3 with a N terminal proprietary tag: predicted molecular weight 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELP* |
| Sequence Similarities : | Belongs to the DSH family.Contains 1 DEP domain.Contains 1 DIX domain.Contains 1 PDZ (DHR) domain. |
| Gene Name | DVL3 dishevelled, dsh homolog 3 (Drosophila) [ Homo sapiens ] |
| Official Symbol | DVL3 |
| Synonyms | DVL3; dishevelled, dsh homolog 3 (Drosophila); dishevelled 3 (homologous to Drosophila dsh); segment polarity protein dishevelled homolog DVL-3; KIAA0208; |
| Gene ID | 1857 |
| mRNA Refseq | NM_004423 |
| Protein Refseq | NP_004414 |
| MIM | 601368 |
| Uniprot ID | Q92997 |
| Chromosome Location | 3q27 |
| Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; HTLV-I infection, organism-specific biosystem; |
| Function | beta-catenin binding; frizzled binding; protease binding; protein binding; protein heterodimerization activity; |
| ◆ Recombinant Proteins | ||
| DVL3-2576M | Recombinant Mouse DVL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DVL3-4137HF | Recombinant Full Length Human DVL3 Protein, GST-tagged | +Inquiry |
| DVL3-28353TH | Recombinant Human DVL3 | +Inquiry |
| DVL3-142HF | Recombinant Full Length Human DVL3 Protein | +Inquiry |
| DVL3-2961H | Recombinant Human DVL3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DVL3-6764HCL | Recombinant Human DVL3 293 Cell Lysate | +Inquiry |
| CPBT-Y0051RH | Goat Anti-Human DVL3 Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DVL3 Products
Required fields are marked with *
My Review for All DVL3 Products
Required fields are marked with *
