Recombinant Human DYNLL2 Protein, GST-tagged
Cat.No. : | DYNLL2-2974H |
Product Overview : | Human Dlc2 partial ORF ( NP_542408, 1 a.a. - 72 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DYNLL2 (Dynein Light Chain LC8-Type 2) is a Protein Coding gene. Among its related pathways are Innate Immune System and Activation of BH3-only proteins. GO annotations related to this gene include motor activity and cytoskeletal protein binding. An important paralog of this gene is DYNLL1. |
Molecular Mass : | 33.66 kDa |
AA Sequence : | MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DYNLL2 dynein, light chain, LC8-type 2 [ Homo sapiens ] |
Official Symbol | DYNLL2 |
Synonyms | DYNLL2; dynein, light chain, LC8-type 2; dynein light chain 2, cytoplasmic; Dlc2; DNCL1B; MGC17810; radial spoke 22 homolog (Chlamydomonas); RSPH22; DLC8b; radial spoke 22 homolog; 8 kDa dynein light chain b; |
Gene ID | 140735 |
mRNA Refseq | NM_080677 |
Protein Refseq | NP_542408 |
MIM | 608942 |
UniProt ID | Q96FJ2 |
◆ Recombinant Proteins | ||
Dynll2-2699M | Recombinant Mouse Dynll2 Protein, Myc/DDK-tagged | +Inquiry |
DYNLL2-1988R | Recombinant Rat DYNLL2 Protein | +Inquiry |
DYNLL2-5633C | Recombinant Chicken DYNLL2 | +Inquiry |
DYNLL2-1646R | Recombinant Rat DYNLL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DYNLL2-3698H | Recombinant Human DYNLL2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYNLL2-6756HCL | Recombinant Human DYNLL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DYNLL2 Products
Required fields are marked with *
My Review for All DYNLL2 Products
Required fields are marked with *