Recombinant Human DYNLL2 Protein, GST-tagged

Cat.No. : DYNLL2-2974H
Product Overview : Human Dlc2 partial ORF ( NP_542408, 1 a.a. - 72 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DYNLL2 (Dynein Light Chain LC8-Type 2) is a Protein Coding gene. Among its related pathways are Innate Immune System and Activation of BH3-only proteins. GO annotations related to this gene include motor activity and cytoskeletal protein binding. An important paralog of this gene is DYNLL1.
Molecular Mass : 33.66 kDa
AA Sequence : MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DYNLL2 dynein, light chain, LC8-type 2 [ Homo sapiens ]
Official Symbol DYNLL2
Synonyms DYNLL2; dynein, light chain, LC8-type 2; dynein light chain 2, cytoplasmic; Dlc2; DNCL1B; MGC17810; radial spoke 22 homolog (Chlamydomonas); RSPH22; DLC8b; radial spoke 22 homolog; 8 kDa dynein light chain b;
Gene ID 140735
mRNA Refseq NM_080677
Protein Refseq NP_542408
MIM 608942
UniProt ID Q96FJ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DYNLL2 Products

Required fields are marked with *

My Review for All DYNLL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon