"DYNLRB1" Related Products

Expand

Recombinant Human DYNLRB1 protein, His-tagged

Cat.No.: DYNLRB1-273H
Product Overview: Recombinant Human DYNLRB1(1 - 96 aa) fused with His tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: His
Form: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
Protein length: 1 - 96 aa
AA Sequence: MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKK NEIMVAPDKDYFLIVIQNPTE
Purity: > 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).
Gene Name: DYNLRB1 dynein, light chain, roadblock-type 1 [ Homo sapiens ]
Official Symbol: DYNLRB1
Synonyms: DYNLRB1; dynein, light chain, roadblock-type 1; DNCL2A, dynein, cytoplasmic, light polypeptide 2A; dynein light chain roadblock-type 1; DNLC2A; roadblock domain containing 1; ROBLD1; Roadblock-1; ROBL/LC7-like 1; bithoraxoid-like protein; dynein-associated protein Km23; dynein-associated protein HKM23; cytoplasmic dynein light chain 2A; dynein light chain 2A, cytoplasmic; roadblock domain-containing protein 1; dynein, cytoplasmic, light polypeptide 2A; BLP; BITH; DNCL2A;
Gene ID: 83658
mRNA Refseq: NM_014183
Protein Refseq: NP_054902
MIM: 607167
UniProt ID: Q9NP97
Chromosome Location: 20q11.21
Pathway: TGF-beta receptor signaling, organism-specific biosystem;
Function: identical protein binding; microtubule motor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.