Recombinant Human DYNLRB1 protein, His-tagged

Cat.No. : DYNLRB1-273H
Product Overview : Recombinant Human DYNLRB1(1 - 96 aa) fused with His tag at N-terminal was expressed in E. coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1 - 96 aa
Form : Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
AA Sequence : MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKK NEIMVAPDKDYFLIVIQNPTE
Purity : > 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping : The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).
Gene Name DYNLRB1 dynein, light chain, roadblock-type 1 [ Homo sapiens ]
Official Symbol DYNLRB1
Synonyms DYNLRB1; dynein, light chain, roadblock-type 1; DNCL2A, dynein, cytoplasmic, light polypeptide 2A; dynein light chain roadblock-type 1; DNLC2A; roadblock domain containing 1; ROBLD1; Roadblock-1; ROBL/LC7-like 1; bithoraxoid-like protein; dynein-associated protein Km23; dynein-associated protein HKM23; cytoplasmic dynein light chain 2A; dynein light chain 2A, cytoplasmic; roadblock domain-containing protein 1; dynein, cytoplasmic, light polypeptide 2A; BLP; BITH; DNCL2A;
Gene ID 83658
mRNA Refseq NM_014183
Protein Refseq NP_054902
MIM 607167
UniProt ID Q9NP97
Chromosome Location 20q11.21
Pathway TGF-beta receptor signaling, organism-specific biosystem;
Function identical protein binding; microtubule motor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DYNLRB1 Products

Required fields are marked with *

My Review for All DYNLRB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon