Recombinant Human DYNLRB2 Protein, His-tagged
| Cat.No. : | DYNLRB2-2977H |
| Product Overview : | Human DYNLRB2 (NP_570967, 1 a.a. - 96 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | DYNLRB2 (Dynein Light Chain Roadblock-Type 2) is a Protein Coding gene. Among its related pathways are Organelle biogenesis and maintenance and Cell cycle_Spindle assembly and chromosome separation. GO annotations related to this gene include microtubule motor activity. An important paralog of this gene is DYNLRB1. |
| Form : | Liquid |
| Molecular Mass : | 13 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCE |
| Purity : | > 90% by SDS - PAGE |
| Applications : | SDS-PAGE |
| Storage : | Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Concentration : | 0.5 mg/mL |
| Storage Buffer : | In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (1 mM dithiothreitol, 20% glycerol) |
| Gene Name | DYNLRB2 dynein, light chain, roadblock-type 2 [ Homo sapiens ] |
| Official Symbol | DYNLRB2 |
| Synonyms | DYNLRB2; dynein, light chain, roadblock-type 2; DNCL2B, dynein, cytoplasmic, light polypeptide 2B; dynein light chain roadblock-type 2; DNLC2B; roadblock domain containing 2; ROBLD2; bithoraxoid-like protein; dynein light chain 2B, cytoplasmic; roadblock domain-containing protein 2; dynein, cytoplasmic, light polypeptide 2B; DNCL2B; MGC62033; |
| Gene ID | 83657 |
| mRNA Refseq | NM_130897 |
| Protein Refseq | NP_570967 |
| MIM | 607168 |
| UniProt ID | Q8TF09 |
| ◆ Recombinant Proteins | ||
| DYNLRB2-1361R | Recombinant Rhesus monkey DYNLRB2 Protein, His-tagged | +Inquiry |
| DYNLRB2-4915M | Recombinant Mouse DYNLRB2 Protein | +Inquiry |
| DYNLRB2-12234H | Recombinant Human DYNLRB2, GST-tagged | +Inquiry |
| DYNLRB2-1186R | Recombinant Rhesus Macaque DYNLRB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DYNLRB2-5056H | Recombinant Human DYNLRB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DYNLRB2 Products
Required fields are marked with *
My Review for All DYNLRB2 Products
Required fields are marked with *




