Recombinant Human DYNLRB2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DYNLRB2-5056H |
| Product Overview : | DYNLRB2 MS Standard C13 and N15-labeled recombinant protein (NP_570967) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. |
| Molecular Mass : | 10.7 kDa |
| AA Sequence : | MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | DYNLRB2 dynein light chain roadblock-type 2 [ Homo sapiens (human) ] |
| Official Symbol | DYNLRB2 |
| Synonyms | DYNLRB2; dynein, light chain, roadblock-type 2; DNCL2B, dynein, cytoplasmic, light polypeptide 2B; dynein light chain roadblock-type 2; DNLC2B; roadblock domain containing 2; ROBLD2; bithoraxoid-like protein; dynein light chain 2B, cytoplasmic; roadblock domain-containing protein 2; dynein, cytoplasmic, light polypeptide 2B; DNCL2B; MGC62033; |
| Gene ID | 83657 |
| mRNA Refseq | NM_130897 |
| Protein Refseq | NP_570967 |
| MIM | 607168 |
| UniProt ID | Q8TF09 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DYNLRB2 Products
Required fields are marked with *
My Review for All DYNLRB2 Products
Required fields are marked with *




