Recombinant Human DYNLRB2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DYNLRB2-5056H |
Product Overview : | DYNLRB2 MS Standard C13 and N15-labeled recombinant protein (NP_570967) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. |
Molecular Mass : | 10.7 kDa |
AA Sequence : | MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DYNLRB2 dynein light chain roadblock-type 2 [ Homo sapiens (human) ] |
Official Symbol | DYNLRB2 |
Synonyms | DYNLRB2; dynein, light chain, roadblock-type 2; DNCL2B, dynein, cytoplasmic, light polypeptide 2B; dynein light chain roadblock-type 2; DNLC2B; roadblock domain containing 2; ROBLD2; bithoraxoid-like protein; dynein light chain 2B, cytoplasmic; roadblock domain-containing protein 2; dynein, cytoplasmic, light polypeptide 2B; DNCL2B; MGC62033; |
Gene ID | 83657 |
mRNA Refseq | NM_130897 |
Protein Refseq | NP_570967 |
MIM | 607168 |
UniProt ID | Q8TF09 |
◆ Recombinant Proteins | ||
DYNLRB2-4994C | Recombinant Chicken DYNLRB2 | +Inquiry |
DYNLRB2-3424H | Recombinant Human DYNLRB2 protein, His-tagged | +Inquiry |
DYNLRB2-2977H | Recombinant Human DYNLRB2 Protein, His-tagged | +Inquiry |
DYNLRB2-12234H | Recombinant Human DYNLRB2, GST-tagged | +Inquiry |
DYNLRB2-1361R | Recombinant Rhesus monkey DYNLRB2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DYNLRB2 Products
Required fields are marked with *
My Review for All DYNLRB2 Products
Required fields are marked with *
0
Inquiry Basket