Recombinant Human DYNLRB2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DYNLRB2-5056H
• Product Overview: DYNLRB2 MS Standard C13 and N15-labeled recombinant protein (NP_570967) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.
• Molecular Mass: 10.7 kDa
• AA Sequence: MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DYNLRB2 dynein light chain roadblock-type 2 [ Homo sapiens (human) ]
• Official Symbol: DYNLRB2
• Synonyms: DYNLRB2; dynein, light chain, roadblock-type 2; DNCL2B, dynein, cytoplasmic, light polypeptide 2B; dynein light chain roadblock-type 2; DNLC2B; roadblock domain containing 2; ROBLD2; bithoraxoid-like protein; dynein light chain 2B, cytoplasmic; roadblock domain-containing protein 2; dynein, cytoplasmic, light polypeptide 2B; DNCL2B; MGC62033
• Gene ID: 83657
• mRNA Refseq: NM_130897
• Protein Refseq: NP_570967
• MIM: 607168
• UniProt ID: Q8TF09