Recombinant Human DYRK3 Protein, GST-tagged

Cat.No. : DYRK3-2990H
Product Overview : Human DYRK3 full-length ORF ( AAH15501, 1 a.a. - 568 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Molecular Mass : 88.22 kDa
AA Sequence : MKWKEKLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVHKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS
Applications : Kinase Assay
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DYRK3 dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [ Homo sapiens ]
Official Symbol DYRK3
Synonyms DYRK3; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3; dual specificity tyrosine-phosphorylation-regulated kinase 3; dual specificity tyrosine (Y) phosphorylation regulated kinase 5; hYAK3 2; protein kinase Dyrk3; RED; REDK; regulatory erythroid kinase; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 5; DYRK5; hYAK3-2;
Gene ID 8444
mRNA Refseq NM_001004023
Protein Refseq NP_001004023
MIM 603497
UniProt ID O43781

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DYRK3 Products

Required fields are marked with *

My Review for All DYRK3 Products

Required fields are marked with *

0
cart-icon