Recombinant Human DYRK3 Protein, GST-tagged
Cat.No. : | DYRK3-2990H |
Product Overview : | Human DYRK3 full-length ORF ( AAH15501, 1 a.a. - 568 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 88.22 kDa |
AA Sequence : | MKWKEKLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVHKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS |
Applications : | Kinase Assay Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DYRK3 dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [ Homo sapiens ] |
Official Symbol | DYRK3 |
Synonyms | DYRK3; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3; dual specificity tyrosine-phosphorylation-regulated kinase 3; dual specificity tyrosine (Y) phosphorylation regulated kinase 5; hYAK3 2; protein kinase Dyrk3; RED; REDK; regulatory erythroid kinase; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 5; DYRK5; hYAK3-2; |
Gene ID | 8444 |
mRNA Refseq | NM_001004023 |
Protein Refseq | NP_001004023 |
MIM | 603497 |
UniProt ID | O43781 |
◆ Recombinant Proteins | ||
DYRK3-0400H | Recombinant Human DYRK3 Protein (G2-S588), Tag Free | +Inquiry |
DYRK3-2989H | Active Recombinant Human DYRK3 Protein, GST-tagged | +Inquiry |
DYRK3-220C | Recombinant Cynomolgus Monkey DYRK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DYRK3-5436HF | Active Recombinant Full Length Human DYRK3 Protein, GST-tagged | +Inquiry |
DYRK3-4092HF | Recombinant Full Length Human DYRK3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYRK3-623HCL | Recombinant Human DYRK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DYRK3 Products
Required fields are marked with *
My Review for All DYRK3 Products
Required fields are marked with *
0
Inquiry Basket