Recombinant Human E2F6
Cat.No. : | E2F6-26508TH |
Product Overview : | Recombinant full length Human E2F6 with N-terminal proprietary tag.Mol Wt 56.65 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 281 amino acids |
Description : | This gene encodes a member of the E2F transcription factor protein family. E2F family members play a crucial role in control of the cell cycle and of the action of tumor suppressor proteins. They are also a target of the transforming proteins of small DNA tumor viruses. Many E2F proteins contain several evolutionarily conserved domains: a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. The encoded protein of this gene is atypical because it lacks the transactivation and tumor suppressor protein association domains. It contains a modular suppression domain and is an inhibitor of E2F-dependent transcription. The protein is part of a multimeric protein complex that contains a histone methyltransferase and the transcription factors Mga and Max. Multiple transcript variants have been reported for this gene, but it has not been clearly demonstrated that they encode valid isoforms. |
Molecular Weight : | 56.650kDa |
Tissue specificity : | Expressed in all tissues examined. Highest levels in placenta, skeletal muscle, heart, ovary, kidney, small intestine and spleen. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKI RINLEDNVQYVSMRKALKVKRPRFDVSLVYLTRKFMDLVR SAPGGILDLNKVATKLGVRKRRVYDITNVLDGIDLVEKKS KNHIRWIGSDLSNFGAVPQQKKLQEELSDLSAMEDALDEL IKDCAQQLFELTDDKENERLAYVTYQDIHSIQAFHEQIVI AVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQ GQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVS N |
Sequence Similarities : | Belongs to the E2F/DP family. |
Gene Name | E2F6 E2F transcription factor 6 [ Homo sapiens ] |
Official Symbol | E2F6 |
Synonyms | E2F6; E2F transcription factor 6; transcription factor E2F6; E2F 6; |
Gene ID | 1876 |
mRNA Refseq | NM_198256 |
Protein Refseq | NP_937987 |
MIM | 602944 |
Uniprot ID | O75461 |
Chromosome Location | 2p25.1 |
Pathway | Cell cycle, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; G1 to S cell cycle control, organism-specific biosystem; |
Function | DNA binding; sequence-specific DNA binding transcription factor activity; transcription corepressor activity; |
◆ Recombinant Proteins | ||
E2F6-1368R | Recombinant Rhesus monkey E2F6 Protein, His-tagged | +Inquiry |
E2F6-4519C | Recombinant Chicken E2F6 | +Inquiry |
E2F6-4935M | Recombinant Mouse E2F6 Protein | +Inquiry |
E2F6-12249H | Recombinant Human E2F6, GST-tagged | +Inquiry |
E2F6-221C | Recombinant Cynomolgus Monkey E2F6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
E2F6-521HCL | Recombinant Human E2F6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All E2F6 Products
Required fields are marked with *
My Review for All E2F6 Products
Required fields are marked with *
0
Inquiry Basket