Recombinant Human EAF1 protein, GST-tagged
Cat.No. : | EAF1-3014H |
Product Overview : | Recombinant Human EAF1 protein(NP_149074)(1-268 aa), fused with GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-268 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEFVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPPPPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNALRNDLQLSESGSDSDD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | EAF1 ELL associated factor 1 [ Homo sapiens ] |
Official Symbol | EAF1 |
Synonyms | EAF1; ELL associated factor 1; ELL-associated factor 1; ELL (eleven nineteen lysine-rich leukemia gene)-associated factor 1; |
Gene ID | 85403 |
mRNA Refseq | NM_033083 |
Protein Refseq | NP_149074 |
MIM | 608315 |
UniProt ID | Q96JC9 |
◆ Recombinant Proteins | ||
Eaf1-2709M | Recombinant Mouse Eaf1 Protein, Myc/DDK-tagged | +Inquiry |
EAF1-6349H | Recombinant Human EAF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EAF1-4121HF | Recombinant Full Length Human EAF1 Protein, GST-tagged | +Inquiry |
EAF1-3014H | Recombinant Human EAF1 protein, GST-tagged | +Inquiry |
EAF1-3013H | Recombinant Human EAF1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EAF1-6739HCL | Recombinant Human EAF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EAF1 Products
Required fields are marked with *
My Review for All EAF1 Products
Required fields are marked with *