Recombinant Human EBF1 protein, GST-tagged

Cat.No. : EBF1-321H
Product Overview : Recombinant Human EBF1(4-350aa) fused with GST tag at N-terminal was expressed in E. coli.
Availability August 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 4-350 a.a.
Description : EBF1 played an important role in many functions.
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
Molecular Mass : 64 kDa
AA Sequence : IQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQ GQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRV LLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAV SDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSE LITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEP
Storage : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconsititute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconsitution with 200 μl 50% glycerol solution is recommended for longer term storage.If a different concentration is needed for your purposes please adjust the reconsitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconsituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name EBF1 early B-cell factor 1 [ Homo sapiens ]
Official Symbol EBF1
Synonyms EBF1; early B-cell factor 1; early B cell factor , EBF; transcription factor COE1; OLF1; OE-1; olfactory neuronal transcription factor 1; Collier, Olf and EBF transcription factor 1; EBF; COE1; O/E-1; FLJ39389; FLJ41763;
Gene ID 1879
mRNA Refseq NM_024007
Protein Refseq NP_076870
MIM 164343
UniProt ID Q9UH73
Chromosome Location 5q34
Pathway Adipogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem;
Function C2H2 zinc finger domain binding; DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EBF1 Products

Required fields are marked with *

My Review for All EBF1 Products

Required fields are marked with *

0
cart-icon