Recombinant Human EBF1 protein, GST-tagged

• Cat.No.: EBF1-321H
• Product Overview: Recombinant Human EBF1(4-350aa) fused with GST tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 4-350 a.a.
• Description: EBF1 played an important role in many functions.
• Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
• Molecular Mass: 64 kDa
• AA Sequence: IQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQ GQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRV LLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAV SDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSE LITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEP
• Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconsititute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconsitution with 200 μl 50% glycerol solution is recommended for longer term storage.If a different concentration is needed for your purposes please adjust the reconsitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconsituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: EBF1 early B-cell factor 1 [ Homo sapiens ]
• Official Symbol: EBF1
• Synonyms: EBF1; early B-cell factor 1; early B cell factor , EBF; transcription factor COE1; OLF1; OE-1; olfactory neuronal transcription factor 1; Collier, Olf and EBF transcription factor 1; EBF; COE1; O/E-1; FLJ39389; FLJ41763
• Gene ID: 1879
• mRNA Refseq: NM_024007
• Protein Refseq: NP_076870
• MIM: 164343
• UniProt ID: Q9UH73
• Chromosome Location: 5q34
• Pathway: Adipogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem
• Function: C2H2 zinc finger domain binding; DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity