Recombinant Human ECEL1 protein, His-tagged
Cat.No. : | ECEL1-3421H |
Product Overview : | Recombinant Human ECEL1 protein(425-775 aa), fused to His tag, was expressed in E. coli. |
Availability | September 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 425-775 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AQEMEGSDKPQELARVCLGQANRHFGMALGALFVHEHFSAASKAKVQQLVEDIKYILGQRLEELDWMDAETRAAARAKLQYMMVMVGYPDFLLKPDAVDKEYEFEVHEKTYFKNILNSIRFSIQLSVKKIRQEVDKSTWLLPPQALNAYYLPNKNQMVFPAGILQPTLYDPDFPQSLNYGGIGTIIGHELTHGYDDWGGQYDRSGNLLHWWTEASYSRFLRKAECIVRLYDNFTVYNQRVNGKHTLGENIADMGGLKLAYHAYQKWVREHGPEHPLPRLKYTHDQLFFIAFAQNWCIKRRSQSIYLQVLTDKHAPEHYRVLGSVSQFEEFGRAFHCPKDSPMNPAHKCSVW |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ECEL1 endothelin converting enzyme-like 1 [ Homo sapiens ] |
Official Symbol | ECEL1 |
Synonyms | endothelin converting enzyme-like 1; 3147; Ensembl:ENSG00000171551; endothelin-converting enzyme-like 1;X converting enzyme;damage induced neuronal endopeptidase; XCE; DINE; ECEX |
Gene ID | 9427 |
mRNA Refseq | NM_004826.2 |
Protein Refseq | NP_004817.2 |
MIM | 605896 |
UniProt ID | O95672 |
◆ Recombinant Proteins | ||
RFL12393HF | Recombinant Full Length Human Endothelin-Converting Enzyme-Like 1(Ecel1) Protein, His-Tagged | +Inquiry |
ECEL1-12266H | Recombinant Human ECEL1, GST-tagged | +Inquiry |
ECEL1-3421H | Recombinant Human ECEL1 protein, His-tagged | +Inquiry |
ECEL1-4157HF | Recombinant Full Length Human ECEL1 Protein, GST-tagged | +Inquiry |
ECEL1-2000R | Recombinant Rat ECEL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECEL1-6731HCL | Recombinant Human ECEL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ECEL1 Products
Required fields are marked with *
My Review for All ECEL1 Products
Required fields are marked with *