Recombinant Human ECH1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ECH1-2849H |
Product Overview : | ECH1 MS Standard C13 and N15-labeled recombinant protein (NP_001389) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators. |
Molecular Mass : | 35.8 kDa |
AA Sequence : | MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEAASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ECH1 enoyl-CoA hydratase 1 [ Homo sapiens (human) ] |
Official Symbol | ECH1 |
Synonyms | ECH1; enoyl CoA hydratase 1, peroxisomal; enoyl Coenzyme A hydratase 1, peroxisomal; delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial; HPXEL; dienoyl-CoA isomerase; peroxisomal enoyl-CoA hydratase 1; delta3,5-delta2,4-dienoyl-CoA isomerase; |
Gene ID | 1891 |
mRNA Refseq | NM_001398 |
Protein Refseq | NP_001389 |
MIM | 600696 |
UniProt ID | Q13011 |
◆ Recombinant Proteins | ||
ECH1-1658R | Recombinant Rat ECH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ECH1-2812H | Recombinant Human Enoyl CoA Hydratase 1, Peroxisomal, His-tagged | +Inquiry |
ECH1-486H | Recombinant Human ECH1, His tagged | +Inquiry |
ECH1-4161HF | Recombinant Full Length Human ECH1 Protein, GST-tagged | +Inquiry |
ECH1-1577Z | Recombinant Zebrafish ECH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECH1-6730HCL | Recombinant Human ECH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ECH1 Products
Required fields are marked with *
My Review for All ECH1 Products
Required fields are marked with *
0
Inquiry Basket