Recombinant Human ECHDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ECHDC1-2302H |
Product Overview : | ECHDC1 MS Standard C13 and N15-labeled recombinant protein (NP_001132982) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Decarboxylates ethylmalonyl-CoA, a potentially toxic metabolite, to form butyryl-CoA, suggesting it might be involved in metabolite proofreading. Also has methylmalonyl-CoA decarboxylase activity at lower level. |
Molecular Mass : | 33.5 kDa |
AA Sequence : | MALKQEMAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIAKKGKFNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ECHDC1 enoyl CoA hydratase domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | ECHDC1 |
Synonyms | ECHDC1; enoyl CoA hydratase domain containing 1; enoyl Coenzyme A hydratase domain containing 1; ethylmalonyl-CoA decarboxylase; dJ351K20.2; methylmalonyl-CoA decarboxylase; enoyl-CoA hydratase domain-containing protein 1; MMCD; FLJ40827; DKFZp762M1110; |
Gene ID | 55862 |
mRNA Refseq | NM_001139510 |
Protein Refseq | NP_001132982 |
MIM | 612136 |
UniProt ID | Q9NTX5 |
◆ Recombinant Proteins | ||
ECHDC1-1373R | Recombinant Rhesus monkey ECHDC1 Protein, His-tagged | +Inquiry |
ECHDC1-1659R | Recombinant Rat ECHDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Echdc1-2717M | Recombinant Mouse Echdc1 Protein, Myc/DDK-tagged | +Inquiry |
ECHDC1-4163HF | Recombinant Full Length Human ECHDC1 Protein, GST-tagged | +Inquiry |
ECHDC1-1924H | Recombinant Human Enoyl CoA Hydratase Domain Containing 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECHDC1-526HCL | Recombinant Human ECHDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ECHDC1 Products
Required fields are marked with *
My Review for All ECHDC1 Products
Required fields are marked with *
0
Inquiry Basket