Recombinant Human ECHDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ECHDC1-2302H |
| Product Overview : | ECHDC1 MS Standard C13 and N15-labeled recombinant protein (NP_001132982) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Decarboxylates ethylmalonyl-CoA, a potentially toxic metabolite, to form butyryl-CoA, suggesting it might be involved in metabolite proofreading. Also has methylmalonyl-CoA decarboxylase activity at lower level. |
| Molecular Mass : | 33.5 kDa |
| AA Sequence : | MALKQEMAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIAKKGKFNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ECHDC1 enoyl CoA hydratase domain containing 1 [ Homo sapiens (human) ] |
| Official Symbol | ECHDC1 |
| Synonyms | ECHDC1; enoyl CoA hydratase domain containing 1; enoyl Coenzyme A hydratase domain containing 1; ethylmalonyl-CoA decarboxylase; dJ351K20.2; methylmalonyl-CoA decarboxylase; enoyl-CoA hydratase domain-containing protein 1; MMCD; FLJ40827; DKFZp762M1110; |
| Gene ID | 55862 |
| mRNA Refseq | NM_001139510 |
| Protein Refseq | NP_001132982 |
| MIM | 612136 |
| UniProt ID | Q9NTX5 |
| ◆ Recombinant Proteins | ||
| ECHDC1-4163HF | Recombinant Full Length Human ECHDC1 Protein, GST-tagged | +Inquiry |
| ECHDC1-2749Z | Recombinant Zebrafish ECHDC1 | +Inquiry |
| ECHDC1-1659R | Recombinant Rat ECHDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ECHDC1-3032H | Recombinant Human ECHDC1 Protein, GST-tagged | +Inquiry |
| ECHDC1-2002R | Recombinant Rat ECHDC1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ECHDC1-526HCL | Recombinant Human ECHDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ECHDC1 Products
Required fields are marked with *
My Review for All ECHDC1 Products
Required fields are marked with *
