Recombinant Human ECHDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ECHDC1-2302H
Product Overview : ECHDC1 MS Standard C13 and N15-labeled recombinant protein (NP_001132982) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Decarboxylates ethylmalonyl-CoA, a potentially toxic metabolite, to form butyryl-CoA, suggesting it might be involved in metabolite proofreading. Also has methylmalonyl-CoA decarboxylase activity at lower level.
Molecular Mass : 33.5 kDa
AA Sequence : MALKQEMAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIAKKGKFNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ECHDC1 enoyl CoA hydratase domain containing 1 [ Homo sapiens (human) ]
Official Symbol ECHDC1
Synonyms ECHDC1; enoyl CoA hydratase domain containing 1; enoyl Coenzyme A hydratase domain containing 1; ethylmalonyl-CoA decarboxylase; dJ351K20.2; methylmalonyl-CoA decarboxylase; enoyl-CoA hydratase domain-containing protein 1; MMCD; FLJ40827; DKFZp762M1110;
Gene ID 55862
mRNA Refseq NM_001139510
Protein Refseq NP_001132982
MIM 612136
UniProt ID Q9NTX5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ECHDC1 Products

Required fields are marked with *

My Review for All ECHDC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon